BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H08 (533 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 25 1.6 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 1.6 AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside ... 24 2.8 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 24 2.8 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 2.8 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 369 VVLLYCVLRLNI*ILVDLPSVFSFTFPIDSYFSK 470 + + CVL + I++ PS++ T PID+ +SK Sbjct: 509 IFTIACVLGTCL-IILQAPSLYDNTQPIDAMYSK 541 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.0 bits (52), Expect = 1.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 295 CIHSKVFTAQLKLWVIWFSIIIYQLL 372 CI +VFT++ +W F I I++LL Sbjct: 1007 CIRHRVFTSKSDVWA--FGITIWELL 1030 >AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside phosphorylase protein. Length = 353 Score = 24.2 bits (50), Expect = 2.8 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 496 TFAAENRNCFEKYESIGKVKENTLGRSTS 410 ++ E +C + +GK +E TLG S Sbjct: 313 SYEEEEEHCHDSIVGVGKNREKTLGEFVS 341 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 24.2 bits (50), Expect = 2.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 196 CYHYDLANFYSDDLTSTENYSC 131 CY+Y N DD T + YSC Sbjct: 200 CYYYYYYNEEEDDDTYQDYYSC 221 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.2 bits (50), Expect = 2.8 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 229 PLYTLNDFGITCYHYDLANFYSDDLT 152 PL T + GI C DL N Y+DD++ Sbjct: 664 PLITRLE-GICCDQDDLVNAYADDIS 688 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 535,840 Number of Sequences: 2352 Number of extensions: 10983 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -