BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H08 (533 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 24 1.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 7.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 7.9 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.8 bits (49), Expect = 1.1 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 384 CVLRLNI*ILVDLPSVFSFTFPIDSYFSK 470 CVL + I++ PS++ T PID +SK Sbjct: 558 CVLG-TVLIILQAPSLYDTTKPIDIKYSK 585 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = -2 Query: 241 IREKPLYTLNDFGITCYHYDLANFYSDDLTSTE 143 + K +Y + D G+ Y++ L + L S E Sbjct: 216 LENKLIYFIEDIGLNTYYFFLRQAFPFWLPSKE 248 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 7.9 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = +3 Query: 42 KVYLCYICFFP 74 ++Y CY+C+ P Sbjct: 1064 RLYDCYVCYSP 1074 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,579 Number of Sequences: 438 Number of extensions: 3195 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15090993 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -