BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H07 (455 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles ... 258 5e-71 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 3.9 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 3.9 AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translati... 22 8.9 >U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S13 mRNA, complete cds. ). Length = 151 Score = 258 bits (633), Expect = 5e-71 Identities = 118/139 (84%), Positives = 133/139 (95%) Frame = +1 Query: 37 MGRMHAPGKGISQSALPYRRSVPTWLKLTADDVKEQIFKLGKKGLTPSQIGVMLRDSHGV 216 MGRMHAPGKGIS+SALPYRRSVP+WLKL+A+DVKEQI KLGKKG+TPSQIG++LRDSHGV Sbjct: 1 MGRMHAPGKGISKSALPYRRSVPSWLKLSAEDVKEQIKKLGKKGMTPSQIGIILRDSHGV 60 Query: 217 AQVRFVTGKKILRIMKAMGLAPDLPEDLYYLIKKAVAMRKHLERNRKDKDSKFRLILVES 396 AQVRFV G K+LRIMKA+GL PD+PEDLY+LIKKAV++RKHLERNRKD DSKFRLIL+ES Sbjct: 61 AQVRFVNGNKVLRIMKAVGLKPDIPEDLYFLIKKAVSIRKHLERNRKDIDSKFRLILIES 120 Query: 397 RIHRLARYYKTKSVLPPNW 453 RIHRLARYYK K+VLPPNW Sbjct: 121 RIHRLARYYKIKAVLPPNW 139 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.4 bits (48), Expect = 3.9 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +1 Query: 211 GVAQVRFVTGKKILRIMKAMGLAPDLPEDLYYLIKK 318 G++ V+F+T ++ I +MG+ L D Y+ ++ Sbjct: 443 GMSTVKFITYQEASEISGSMGVGWSLQVDCVYIDRR 478 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.4 bits (48), Expect = 3.9 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +1 Query: 211 GVAQVRFVTGKKILRIMKAMGLAPDLPEDLYYLIKK 318 G++ V+F+T ++ I +MG+ L D Y+ ++ Sbjct: 444 GMSTVKFITYQEASEISGSMGVGWSLQVDCVYIDRR 479 >AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translation initiation factor protein. Length = 348 Score = 22.2 bits (45), Expect = 8.9 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 112 LKLTADDVKEQIFKL 156 LKL ADDVK Q+ L Sbjct: 95 LKLAADDVKGQVESL 109 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 504,176 Number of Sequences: 2352 Number of extensions: 10439 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39119412 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -