BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H04 (357 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 0.47 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 1.4 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 2.5 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 3.3 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 3.3 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 5.8 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 5.8 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 0.47 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +1 Query: 25 SHKLNSRNDHIHNGEGTATENRRAPPPP 108 SH H++ NRR PPPP Sbjct: 1678 SHSTWDPRRHMYEELNHCAPNRRCPPPP 1705 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.6 bits (46), Expect = 1.4 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 77 PPRIGVHRHRLMYLLRRSLSTWLQAASITTPTHAVVFSL*KRDA*SSVII-TWCQLFVYS 253 P +G+HR +L S A TPT+AVV S V++ +C+L+ Y+ Sbjct: 160 PISLGLHRANEPVVLDDSKEEHPTCALDLTPTYAVVSSSISFYVPCIVMLGIYCRLYCYA 219 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 21.8 bits (44), Expect = 2.5 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 44 GTTIYTMEKEPPPRIGVHRHRLMYLLRRSLSTWLQAASIT 163 GTT T E++P P V H + L + + +Q S T Sbjct: 110 GTTNLTFEEDPEPFGRVRDHNISALCKELGISVVQKVSHT 149 Score = 21.4 bits (43), Expect = 3.3 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -3 Query: 85 SRWRFLLHCV 56 ++WRFLL C+ Sbjct: 68 NKWRFLLQCL 77 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.4 bits (43), Expect = 3.3 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -1 Query: 96 CTPILGGGSFSIVY 55 C LG G F IVY Sbjct: 69 CGTFLGSGGFGIVY 82 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 3.3 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +1 Query: 73 TATENRRAPPPPYVSVEAQPVNVVTSSKYYDSYTCC 180 +A + + P P SV + P V + KY CC Sbjct: 571 SAIQFKLGHPEPPESVCSLPCEVGQAKKYVAGEQCC 606 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 20.6 bits (41), Expect = 5.8 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +1 Query: 100 PPPYVSVEAQPVNVVTSSKYYDSYT 174 P + A+P N+ S+ DS+T Sbjct: 554 PETSKGINAEPSNIEESNNMTDSFT 578 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 20.6 bits (41), Expect = 5.8 Identities = 7/27 (25%), Positives = 13/27 (48%) Frame = +1 Query: 109 YVSVEAQPVNVVTSSKYYDSYTCCGIF 189 ++ E QP+ S + + T C +F Sbjct: 696 FIEAEPQPIGKALSKCHNRNVTTCNMF 722 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,695 Number of Sequences: 438 Number of extensions: 2242 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8308335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -