BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_H01 (495 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) 167 4e-42 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_6617| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_9412| Best HMM Match : Peptidase_M1 (HMM E-Value=3.1e-07) 28 4.9 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 27 6.4 SB_7409| Best HMM Match : DUF963 (HMM E-Value=1.6) 27 6.4 SB_16747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_2504| Best HMM Match : Profilin (HMM E-Value=2.9) 27 8.5 SB_472| Best HMM Match : Cas1p (HMM E-Value=0) 27 8.5 SB_49088| Best HMM Match : 2_5_RNA_ligase (HMM E-Value=3.1) 27 8.5 >SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 167 bits (406), Expect = 4e-42 Identities = 86/159 (54%), Positives = 105/159 (66%) Frame = +2 Query: 2 INHKHDRKVRRTEVKSQDVXXXXXXXXXXXXXXXTNAKFNQIILRRLFMSRINRPPISLS 181 I KH +K R E SQ+V TNAKFNQI+++RL MSR RPP+SL+ Sbjct: 112 IEKKHPKKNYRREPVSQNVYIRLLVKLYRFLSRRTNAKFNQIVMKRLCMSRTKRPPLSLA 171 Query: 182 RLARHMKKPTREGLIAVVVGTVSNDVRLYTVPKMTVAALHVTEKARARILAAGGEILTFD 361 RL R MK + I VVVG++++D R++ VP + + AL +E ARARIL AGGEILTFD Sbjct: 172 RLVRKMKASGHKDKICVVVGSITDDKRIFEVPALKICALRFSETARARILKAGGEILTFD 231 Query: 362 QLALRAPTGRKTVLVQGRRNAREAVRHFGPAPGAPRSHT 478 QLALRAP G+ TVL+QG R AREA RH G APG P S T Sbjct: 232 QLALRAPLGQNTVLLQGPRKAREAERHMGLAPGVPHSDT 270 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 28.7 bits (61), Expect = 2.8 Identities = 22/79 (27%), Positives = 35/79 (44%) Frame = +2 Query: 179 SRLARHMKKPTREGLIAVVVGTVSNDVRLYTVPKMTVAALHVTEKARARILAAGGEILTF 358 SRL MK PT++G+ V VS +T A E+ RAR+L G + Sbjct: 92 SRLYEEMKHPTQDGMFVAVNSEVSVTFVGKEKEDVTFAKCAWFER-RARMLKGFGFVTFR 150 Query: 359 DQLALRAPTGRKTVLVQGR 415 D + + +K ++ G+ Sbjct: 151 DPATIESVLAKKPHILDGK 169 >SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 27.9 bits (59), Expect = 4.9 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 341 GEILTFDQLALRAPTGRKTVLVQGRRNAREAVRHFGPAPGAPRS 472 GE+++ D++ +A R + N EA R F P PG P S Sbjct: 614 GEMMSDDEMKPKARCKRSQSTPIHQENREEAHRPFTPQPGRPLS 657 >SB_6617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 433 CLTSITATLNQYCLTSSGRTE 371 CLTSIT+T Q CLTS T+ Sbjct: 21 CLTSITSTDPQLCLTSITSTD 41 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 433 CLTSITATLNQYCLTSSGRTE 371 CLTSIT+T Q CLTS T+ Sbjct: 81 CLTSITSTDPQLCLTSITSTD 101 Score = 27.5 bits (58), Expect = 6.4 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 Query: 433 CLTSITATLNQYCLTSSGRTE 371 CLTSIT+T Q CLT TE Sbjct: 201 CLTSITSTDPQPCLTGINTTE 221 Score = 27.1 bits (57), Expect = 8.5 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 433 CLTSITATLNQYCLTSSGRTE 371 CLTSIT+T Q CLTS T+ Sbjct: 9 CLTSITSTDPQPCLTSITSTD 29 Score = 27.1 bits (57), Expect = 8.5 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 433 CLTSITATLNQYCLTSSGRTE 371 CLTSIT+T Q CLTS T+ Sbjct: 129 CLTSITSTDPQPCLTSIKSTD 149 >SB_9412| Best HMM Match : Peptidase_M1 (HMM E-Value=3.1e-07) Length = 1844 Score = 27.9 bits (59), Expect = 4.9 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 253 IGDCANDYSDQ-TLACRLLHVACQTGQRNRRSVDTAHK 143 IG+ +N S+ +LA R++H GQ N SV T HK Sbjct: 657 IGESSNSSSNYASLASRIMHGDDVPGQDNDGSVSTIHK 694 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 27.5 bits (58), Expect = 6.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 100 THECQVQPDHPTEIVYEPYQPTSDFFVPFG 189 T + +P PT+I + ++P++DFF P G Sbjct: 16 TKSYKKEPTKPTQIHTKRWRPSTDFFEPDG 45 >SB_7409| Best HMM Match : DUF963 (HMM E-Value=1.6) Length = 183 Score = 27.5 bits (58), Expect = 6.4 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 115 VQPDHPTEIVYEPYQPTSDFFVPF 186 + P P+ I+ PYQP+S P+ Sbjct: 121 INPYQPSSIIINPYQPSSTIINPY 144 >SB_16747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +1 Query: 58 VLETIGKTVQILG*THECQVQPDHPTEIVYEPYQPTSDFFVPFG 189 +++T QI T + +P PT+I + ++P++DFF P G Sbjct: 4 MIDTAADQCQIA--TKSYKKEPIKPTQIHTKRWRPSTDFFEPDG 45 >SB_2504| Best HMM Match : Profilin (HMM E-Value=2.9) Length = 191 Score = 27.1 bits (57), Expect = 8.5 Identities = 26/79 (32%), Positives = 36/79 (45%), Gaps = 2/79 (2%) Frame = +2 Query: 107 NAKFNQIILRRLFMSRINRPPISLSRLARHMKKPTREGLIAVVVGTVSNDVRLYTVPKMT 286 N + NQI +RLF IN PP L+ +A T L + G ND L + T Sbjct: 91 NLQRNQITQKRLFNLLIN-PPTQLAGIAASENNKTVRHLGRHLTGHAKNDA-LSSENNKT 148 Query: 287 VAAL--HVTEKARARILAA 337 V L H+T A+ L++ Sbjct: 149 VRHLGRHLTGHAKNDALSS 167 >SB_472| Best HMM Match : Cas1p (HMM E-Value=0) Length = 932 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = -3 Query: 277 RNSVKPHIIGDCANDYSDQTLACRLLHVACQTGQRNRRSVDTAHKQS 137 R+ + P + Y + T C + H A + +RN R+ +T H QS Sbjct: 495 RHGLAPRMPASDPYGYHNDTGTCHI-HTAERLARRNPRNTETNHDQS 540 >SB_49088| Best HMM Match : 2_5_RNA_ligase (HMM E-Value=3.1) Length = 410 Score = 27.1 bits (57), Expect = 8.5 Identities = 22/81 (27%), Positives = 35/81 (43%) Frame = +2 Query: 119 NQIILRRLFMSRINRPPISLSRLARHMKKPTREGLIAVVVGTVSNDVRLYTVPKMTVAAL 298 N + R + R+NR P L+ R +K+ ++G+I V V + + V Sbjct: 129 NSVARLRGLLRRLNRQPEVLAEYDRIIKEQLQKGIIEEVANLELEGVNHFFSHREVVTKE 188 Query: 299 HVTEKARARILAAGGEILTFD 361 T K R A+ EI+ FD Sbjct: 189 SETTKVRIVYDASAREIV-FD 208 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,893,690 Number of Sequences: 59808 Number of extensions: 319935 Number of successful extensions: 835 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1062812967 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -