SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0003_G24
         (582 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_03_0005 - 8871625-8872616,8872807-8872933,8873466-8874209,887...    31   0.51 

>11_03_0005 -
           8871625-8872616,8872807-8872933,8873466-8874209,
           8874287-8874328,8874898-8874993,8877589-8877662,
           8877681-8878344
          Length = 912

 Score = 31.5 bits (68), Expect = 0.51
 Identities = 17/68 (25%), Positives = 33/68 (48%)
 Frame = -1

Query: 564 KEYKMDQRTNKCYKFHSVGRP*SVAAAICSTEGGQPGQLINSETEAEVLRNLFAQHPAQT 385
           +EY+M+  T+K  K      P S +   CST  G+  + I S++  E  + +  +   + 
Sbjct: 764 QEYRMESETDKSNKNSKQSLPSSSSMTDCSTSSGETFKSIKSQSANESNKTVVVKASYKN 823

Query: 384 LTVSFDVI 361
            T+ F ++
Sbjct: 824 DTIRFKLL 831


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,981,742
Number of Sequences: 37544
Number of extensions: 275281
Number of successful extensions: 659
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 648
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 659
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1364465340
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -