BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G24 (582 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 23 2.9 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 6.7 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 8.9 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 8.9 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +2 Query: 104 LMVLGAILAVCNFFG 148 L+VLG+I+ V +FFG Sbjct: 55 LIVLGSIIFVISFFG 69 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 6.7 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +2 Query: 32 HYTFIYYNKTN*NNVLKCNYMIHCLMVLGAILAVCNFFGSF 154 +Y YN N NN K Y I+ + + + V + G+F Sbjct: 100 NYNNYNYNNNNYNNYKKLYYNINYIEQIPVPVPVPIYCGNF 140 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = -1 Query: 459 PGQLINSETEAEVLRNLFA 403 P L+N++ + + +RN +A Sbjct: 701 PENLVNAQQQVQAVRNYYA 719 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 Query: 218 PPQFCFCRENWLSGCP 265 P QF +NW+ G P Sbjct: 333 PEQFKVIIDNWIKGTP 348 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,058 Number of Sequences: 438 Number of extensions: 2653 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -