BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G22 (448 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC359.03c |||amino acid permease, unknown 8|Schizosaccharomyce... 25 7.0 SPAC1639.02c |trk2|SPAC1F5.12|potassium ion transporter Trk2|Sch... 25 7.0 >SPBC359.03c |||amino acid permease, unknown 8|Schizosaccharomyces pombe|chr 2|||Manual Length = 579 Score = 24.6 bits (51), Expect = 7.0 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -2 Query: 411 KFYETATRSYTIAPIFLSFNSYFMINHQINNGIDAAPNVF 292 K+ + R + LSF + IN NNG D + VF Sbjct: 394 KYTDRLGRPLIAMIVVLSFGFFAYINEANNNGNDISDTVF 433 >SPAC1639.02c |trk2|SPAC1F5.12|potassium ion transporter Trk2|Schizosaccharomyces pombe|chr 1|||Manual Length = 880 Score = 24.6 bits (51), Expect = 7.0 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = -2 Query: 444 KNFSSHNQXRMKFYETATRSYTIAPIFLSFNS 349 K+F+S R+ F T T++ T++ +LS+N+ Sbjct: 430 KSFTSALPRRLTFNRTHTKASTMSLPYLSYNA 461 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,276,330 Number of Sequences: 5004 Number of extensions: 19518 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 164204010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -