BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G22 (448 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069521-1|AAL39666.2| 958|Drosophila melanogaster LD23810p pro... 28 5.0 AE013599-3105|AAF46654.1| 957|Drosophila melanogaster CG9346-PA... 28 5.0 >AY069521-1|AAL39666.2| 958|Drosophila melanogaster LD23810p protein. Length = 958 Score = 28.3 bits (60), Expect = 5.0 Identities = 20/52 (38%), Positives = 25/52 (48%) Frame = +1 Query: 163 RSPAHRGGGANE*RAYSPXTARDCLSSLLIRNYWRGEKSLPREKNVRGSVDS 318 RS + GG ++ R YSP T+R SS RN R S P+ R S S Sbjct: 866 RSHSPFSGGESKRRDYSPETSRSSKSSK--RNRSRSPSSSPKRYTERSSRSS 915 >AE013599-3105|AAF46654.1| 957|Drosophila melanogaster CG9346-PA protein. Length = 957 Score = 28.3 bits (60), Expect = 5.0 Identities = 20/52 (38%), Positives = 25/52 (48%) Frame = +1 Query: 163 RSPAHRGGGANE*RAYSPXTARDCLSSLLIRNYWRGEKSLPREKNVRGSVDS 318 RS + GG ++ R YSP T+R SS RN R S P+ R S S Sbjct: 865 RSHSPFSGGESKRRDYSPETSRSSKSSK--RNRSRSPSSSPKRYTERSSRSS 914 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,625,135 Number of Sequences: 53049 Number of extensions: 242112 Number of successful extensions: 507 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 507 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1435027293 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -