BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G21 (497 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 23 1.5 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 4.7 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 8.1 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 23.0 bits (47), Expect = 1.5 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +2 Query: 188 LHNIVSPDVRGVQYPATLVLSA 253 +H+I+ P V+G+ P T V+ + Sbjct: 144 VHDILQPGVKGLHGPITRVIDS 165 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.4 bits (43), Expect = 4.7 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +2 Query: 143 SDNKTQFEYLLKYSPLHNIVSPDVRGVQYPATLVLSAD 256 S N ++ Y+ KY N+V Q+P T L +D Sbjct: 456 SSNLSKRPYIYKYLDKKNVVVQSWGASQWPDTPDLISD 493 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 20.6 bits (41), Expect = 8.1 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -2 Query: 298 DVLERVQRHDTVVVVCGQHQRRRVLHSSDIRTHN 197 ++LE + V +CG+ R + +RTH+ Sbjct: 240 NLLEEDNQKPNVCRICGKSYARPSTLKTHLRTHS 273 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,021 Number of Sequences: 336 Number of extensions: 2100 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -