BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G18 (161 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75711-4|CAB00030.1| 134|Caenorhabditis elegans Hypothetical pr... 25 5.5 Z81522-2|CAB04238.1| 415|Caenorhabditis elegans Hypothetical pr... 25 9.6 >Z75711-4|CAB00030.1| 134|Caenorhabditis elegans Hypothetical protein K02B12.6 protein. Length = 134 Score = 25.4 bits (53), Expect = 5.5 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 21 FYQQLTTRYYFERLTNGLGSIPEFSWYSPIKTGYYPLMTSYY 146 +Y + Y E NG S E ++Y+PI + Y+ M Y+ Sbjct: 48 YYNTESYGKYDEHGNNGKDSHYEPNYYNPIASYYHSYMPKYH 89 >Z81522-2|CAB04238.1| 415|Caenorhabditis elegans Hypothetical protein F32B4.1 protein. Length = 415 Score = 24.6 bits (51), Expect = 9.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 26 PTINNTLLLRASYKRLGFHT*ILL 97 P I N L +S +RLGFH I+L Sbjct: 126 PFIRNGKRLISSIRRLGFHNKIIL 149 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,623,707 Number of Sequences: 27780 Number of extensions: 52218 Number of successful extensions: 93 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 93 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 12,740,198 effective HSP length: 34 effective length of database: 11,795,678 effective search space used: 224117882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -