BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G17 (481 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 2e-41 SB_29195| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.003 SB_36010| Best HMM Match : Remorin_C (HMM E-Value=6.1) 37 0.010 SB_43824| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) 29 1.5 SB_17138| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_25218| Best HMM Match : zf-AD (HMM E-Value=0.094) 27 6.1 SB_37931| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.1 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_20518| Best HMM Match : Alpha-2-MRAP_N (HMM E-Value=7.4) 27 8.0 >SB_55959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 165 bits (401), Expect = 2e-41 Identities = 78/95 (82%), Positives = 88/95 (92%), Gaps = 2/95 (2%) Frame = +3 Query: 168 RNVRSLEKV--CSDLINGAKKQKLRVKGPVRMPTKVLRITTRKTPCGEGSKTWDRFQMRI 341 + VR+ KV C+DLI GAK++KL+VKGPVRMPTK LRITTRKTPCGEGSKTWDR++MRI Sbjct: 6 KKVRTTRKVTVCADLIRGAKEKKLKVKGPVRMPTKFLRITTRKTPCGEGSKTWDRYEMRI 65 Query: 342 HKRVIDLHSPSEIVKQITSINIEPGVEVEVTIADA 446 HKR+IDLHSPSEIVKQITSI+IEPGVEVEVTIADA Sbjct: 66 HKRLIDLHSPSEIVKQITSISIEPGVEVEVTIADA 100 >SB_29195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 36.7 bits (81), Expect(2) = 0.003 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 1/102 (0%) Frame = +1 Query: 46 VVYLDRNIATTWQPLSCQERISRSPRLRSHRSIVSGSR*R-HAMYAHWRRSALTSSMEPR 222 VV ++ + +P C R+S +P S RS GS R +H RRS+ +E R Sbjct: 335 VVNVESALPLITRPSHCSSRVSPAPSNTSRRSSSRGSVPRPRRSTSHDRRSSSRDRLEMR 394 Query: 223 NKNSV*RVQSECRPRFSASQHVKHLAVRVPRLGTDSRCASTS 348 ++ S R + + R R SAS+ R+P G R S S Sbjct: 395 DRRSASRDRLQMRNRRSASRD------RIPSSGGRRRSPSPS 430 Score = 21.0 bits (42), Expect(2) = 0.003 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = +1 Query: 427 KSPSPTHRHNCQ 462 +SPSP+ +++CQ Sbjct: 425 RSPSPSEQNSCQ 436 >SB_36010| Best HMM Match : Remorin_C (HMM E-Value=6.1) Length = 183 Score = 36.7 bits (81), Expect = 0.010 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 1/102 (0%) Frame = +1 Query: 46 VVYLDRNIATTWQPLSCQERISRSPRLRSHRSIVSGSR*R-HAMYAHWRRSALTSSMEPR 222 VV ++ + +P C R+S +P S RS GS R +H RRS+ +E R Sbjct: 75 VVNVESALPLITRPSHCSSRVSPAPSNTSRRSSSRGSVPRPRRSTSHDRRSSSRDRLEMR 134 Query: 223 NKNSV*RVQSECRPRFSASQHVKHLAVRVPRLGTDSRCASTS 348 ++ S R + + R R SAS+ R+P G R S S Sbjct: 135 DRRSASRDRLQMRNRRSASRD------RIPSSGGRRRSPSPS 170 >SB_43824| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 1.1 Identities = 28/83 (33%), Positives = 39/83 (46%), Gaps = 1/83 (1%) Frame = +1 Query: 103 RISRSPRLRSHRSIVSGSR*R-HAMYAHWRRSALTSSMEPRNKNSV*RVQSECRPRFSAS 279 R+S +P S RS GS R +H RRS+ +E R++ S R + + R R SAS Sbjct: 3 RVSPAPSNTSRRSSSRGSVPRPRRSTSHDRRSSSRDRLEMRDRRSASRDRLQMRNRRSAS 62 Query: 280 QHVKHLAVRVPRLGTDSRCASTS 348 + R+P G R S S Sbjct: 63 RD------RIPSSGGRRRSPSPS 79 >SB_11738| Best HMM Match : SH3_2 (HMM E-Value=3.7e-32) Length = 2436 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 102 KDIEKPQAEISPIHRIRITLTSRNVRSLEKVC 197 + + K Q E + IH + +T ++VRSLE+ C Sbjct: 663 RQLHKIQEESTRIHHLAVTALEKDVRSLEQRC 694 >SB_17138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 27.9 bits (59), Expect = 4.6 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 1/104 (0%) Frame = +3 Query: 96 SGKDIEKPQAEISPIHRIRITLTSR-NVRSLEKVCSDLINGAKKQKLRVKGPVRMPTKVL 272 S + +K ++SP+ RI+ TSR ++ S +DL + K K K P+ P Sbjct: 124 STRSSKKDPDKVSPLSRIKSPATSRVSLDSDSDDGNDLPSVFTKTKPVWKPPITTPQVNS 183 Query: 273 RITTRKTPCGEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSIN 404 P + + D ++R HKR+ D +S ++ S N Sbjct: 184 DSEEEDLPSYLSTNSQDT-KIRTHKRIADNNSKISCRSKVDSQN 226 >SB_25218| Best HMM Match : zf-AD (HMM E-Value=0.094) Length = 436 Score = 27.5 bits (58), Expect = 6.1 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 43 KVVYLDRNIATTWQPLSCQERISRSPRLRSH 135 +V + +++ +WQP C ISR + SH Sbjct: 277 RVTFEQKSLRKSWQPNMCLHDISRDTHVTSH 307 >SB_37931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 361 Score = 27.5 bits (58), Expect = 6.1 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +3 Query: 54 SRPEYRNNMAAAVVSGKDIEKPQAEISPIHRIRITLTSRNVRSLEK 191 ++P N A+ ++S + +PQA I P+H I + SRN ++ K Sbjct: 301 NQPAMTLNSASVILS---LAEPQAGILPVHPHSIEIASRNRDAIAK 343 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 27.1 bits (57), Expect = 8.0 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 42 ESCLSRPEYRNNMAAAVVSGKDIEKP 119 +SC P +++ AA VSG +EKP Sbjct: 1115 KSCAQLPRVMDHVGAACVSGTSMEKP 1140 >SB_20518| Best HMM Match : Alpha-2-MRAP_N (HMM E-Value=7.4) Length = 494 Score = 27.1 bits (57), Expect = 8.0 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 6/39 (15%) Frame = +2 Query: 77 HGSRCRVRKGYREAPG*DL------TDPSYQDHADVTQC 175 HGSRC V+ G + + D D + + H DVT C Sbjct: 438 HGSRCNVKDGSKSSSSHDKCNRSQEADSTPEPHLDVTDC 476 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,601,908 Number of Sequences: 59808 Number of extensions: 353038 Number of successful extensions: 969 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 942 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 969 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -