BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G16 (252 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) 26 4.2 SB_19572| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 5.6 SB_27117| Best HMM Match : SAM_1 (HMM E-Value=6.3e-07) 26 5.6 >SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) Length = 865 Score = 26.2 bits (55), Expect = 4.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 241 MARDSQIERPSSTRRRDRVLRIQLQKFR 158 MARD RP S RRD LR Q R Sbjct: 422 MARDRDDRRPPSRSRRDSSLRRQRSPLR 449 >SB_19572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 823 Score = 25.8 bits (54), Expect = 5.6 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 241 MARDSQIERPSSTRRRDRVLRIQLQKFRFQVLPVV 137 M+ D++ R ++ R RVLRI LQK + P V Sbjct: 609 MSLDARHPRTHASSRLGRVLRISLQKSSASLTPKV 643 >SB_27117| Best HMM Match : SAM_1 (HMM E-Value=6.3e-07) Length = 367 Score = 25.8 bits (54), Expect = 5.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 146 EHLKPEFLKLNPQHTVPTPSR 208 EH KP +K PQ T P SR Sbjct: 89 EHKKPPPVKAKPQKTTPATSR 109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,463,549 Number of Sequences: 59808 Number of extensions: 122767 Number of successful extensions: 220 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 220 length of database: 16,821,457 effective HSP length: 60 effective length of database: 13,232,977 effective search space used: 304358471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -