BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G15 (217 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF497797-1|AAM46869.1| 58|Homo sapiens Alu superfamily-like pr... 29 3.6 AK126716-1|BAC86656.1| 250|Homo sapiens protein ( Homo sapiens ... 28 4.7 >AF497797-1|AAM46869.1| 58|Homo sapiens Alu superfamily-like protein protein. Length = 58 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -2 Query: 168 VRRWYCLNISSVPWDHVEARARRCSGGVSAGKRHHRCNCYYV 43 V+ W L +SS PW H + A + G HH +Y+ Sbjct: 18 VQSW--LTVSSAPWVHASSPASASRVAGTTGAHHHTWLIFYI 57 >AK126716-1|BAC86656.1| 250|Homo sapiens protein ( Homo sapiens cDNA FLJ44762 fis, clone BRACE3031743, moderately similar to Homo sapiens bruno-like 4, RNA binding protein. ). Length = 250 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = -2 Query: 141 SSVPW---DHVEARARRCSGGVSAGKRHHR 61 +S PW D ++A R +GGV AG+RH + Sbjct: 155 TSFPWASADAASSKAPRGAGGVGAGQRHRQ 184 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.316 0.129 0.383 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,585,631 Number of Sequences: 237096 Number of extensions: 671976 Number of successful extensions: 1412 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1412 length of database: 76,859,062 effective HSP length: 50 effective length of database: 65,004,262 effective search space used: 1365089502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -