BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G14 (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0234 + 15187065-15188241,15188316-15188494 44 8e-05 04_03_0649 - 18402976-18403220,18403305-18404499 38 0.007 12_02_0232 - 16015174-16015244,16015861-16016671,16018412-16018861 32 0.34 12_02_0239 - 16125105-16126025,16126966-16127415 31 1.1 08_01_0192 + 1594530-1594682,1594755-1594955,1595051-1595280,159... 30 1.4 05_03_0086 + 8279518-8280320,8280923-8281844 30 1.4 12_02_0234 - 16043995-16044894,16050069-16050200,16050278-16050718 29 3.2 10_08_0009 + 14075929-14076789 29 3.2 01_03_0263 + 14397549-14412911,14413023-14413787,14413950-14414132 29 4.2 12_02_0237 - 16087083-16087201,16087531-16088341,16097713-16098156 28 5.6 02_05_0272 - 27348537-27348728,27349035-27349192,27349292-273493... 28 5.6 08_02_0992 + 23380855-23381195,23382464-23382506,23383306-233833... 28 7.4 07_01_0465 + 3513296-3513631,3514386-3514442,3515196-3515306,351... 27 9.8 04_04_1630 - 34896021-34896143,34896329-34896403,34896500-348965... 27 9.8 04_04_1358 + 32869222-32869306,32869947-32870008,32870301-328703... 27 9.8 >11_04_0234 + 15187065-15188241,15188316-15188494 Length = 451 Score = 44.4 bits (100), Expect = 8e-05 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = +2 Query: 143 LRVFLTVGGDDDTEDPQK--YNLLLESPQARTAFTNSALLLAEQYGFDGIDLSWQLP 307 ++ L++G D+ ED ++ + R AF NS++ LA GFDG+DL+W+ P Sbjct: 109 VKTILSIGTDEFREDVSNAAFSRMASEKNLRRAFINSSIELARANGFDGLDLAWRFP 165 >04_03_0649 - 18402976-18403220,18403305-18404499 Length = 479 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +2 Query: 185 DPQKYNLLLESPQARTAFTNSALLLAEQYGFDGIDLSWQLP 307 DP + + P +R AF +A+ +A + GFDG+D++W+ P Sbjct: 131 DPA-FAAMAADPASRAAFIGAAVKVARENGFDGLDVAWRFP 170 >12_02_0232 - 16015174-16015244,16015861-16016671,16018412-16018861 Length = 443 Score = 32.3 bits (70), Expect = 0.34 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 428 LVREMKQALNVKPNMQLVISVLPNVNSSIYFDVPSIINLVDI 553 LVR+ K + K NMQL++ +LP Y V I DI Sbjct: 340 LVRKAKHEMKTKENMQLMVDLLPLWREKPYIKVERIFETCDI 381 >12_02_0239 - 16125105-16126025,16126966-16127415 Length = 456 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/72 (26%), Positives = 31/72 (43%) Frame = +2 Query: 338 IGSFWHSIKKTFGTTPVDDKESEHREGFTALVREMKQALNVKPNMQLVISVLPNVNSSIY 517 +G + + + T V + + E LVR+ K + + NMQL++ V+P Y Sbjct: 310 LGYYGNGLMYPIVETTVKELCTNPLEHTIELVRKAKHKIRTEENMQLMVDVMPLWYEKPY 369 Query: 518 FDVPSIINLVDI 553 V I DI Sbjct: 370 IKVQRIFETCDI 381 >08_01_0192 + 1594530-1594682,1594755-1594955,1595051-1595280, 1595596-1595766,1595902-1596007,1596339-1596545, 1596638-1596802 Length = 410 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 239 TNSALLLAEQYGFDGIDLSWQLPKRKPKKIRSSIGSFW 352 T +L+ E + FD L+W + R P +I++++ +W Sbjct: 339 TKKMILVGEVFRFDLDTLTWSVIGRMPFRIKTALAGYW 376 >05_03_0086 + 8279518-8280320,8280923-8281844 Length = 574 Score = 30.3 bits (65), Expect = 1.4 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Frame = +2 Query: 203 LLLESPQARTAFTNSALLLAEQYGFDGIDLSWQLPKR-KPKKIRSSIGSFWHSIKKTFGT 379 LL++ P R AFT A + + FDG+ +W L + P + + F T Sbjct: 478 LLVKEPHKRIAFTRGATEIKQHPFFDGV--NWALVRSLTPPSVPEPV-DFRQYAAAASAT 534 Query: 380 TPVDDKESEH 409 TP D K E+ Sbjct: 535 TPKDKKPPEN 544 >12_02_0234 - 16043995-16044894,16050069-16050200,16050278-16050718 Length = 490 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +2 Query: 428 LVREMKQALNVKPNMQLVISVLPNVNSSIYFDVPSIINLVDI 553 LVR+ K + + NMQL + +LP Y V I DI Sbjct: 381 LVRKAKDEMKTEENMQLRVDLLPLWREKPYIKVQRIFEACDI 422 >10_08_0009 + 14075929-14076789 Length = 286 Score = 29.1 bits (62), Expect = 3.2 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 4/76 (5%) Frame = +2 Query: 86 DRAHANYRAITNLKRQFPQLRVFLTVGGDDDTEDPQKYNLLLESPQARTAFTNSALL--- 256 D A+ + A+ K P L V L +GGD T N + A+ +A Sbjct: 62 DTANLSPAAVAAAKAAHPNLSVILALGGD--TVQNTGVNATFAPTSSVDAWVRNAADSVS 119 Query: 257 -LAEQYGFDGIDLSWQ 301 L + YG DG+D+ ++ Sbjct: 120 GLIDAYGLDGVDVDYE 135 >01_03_0263 + 14397549-14412911,14413023-14413787,14413950-14414132 Length = 5436 Score = 28.7 bits (61), Expect = 4.2 Identities = 22/82 (26%), Positives = 32/82 (39%), Gaps = 1/82 (1%) Frame = +2 Query: 128 RQFPQLRVFLTVGGDDDTEDPQKYNLLLESPQARTAFTNSALLLAEQYGFDGIDLSWQLP 307 R P L + + D D +YNLL + A +Y FDG L L Sbjct: 5215 RMSPILNMVIEPSFDFDDPPTHQYNLLEPTSIITRKHVLGAHTWDHEYNFDGASLEKTLV 5274 Query: 308 KRKPKK-IRSSIGSFWHSIKKT 370 KP K +++ F +KK+ Sbjct: 5275 LHKPTKCFEATLVEFSKDMKKS 5296 >12_02_0237 - 16087083-16087201,16087531-16088341,16097713-16098156 Length = 457 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 428 LVREMKQALNVKPNMQLVISVLPNVNSSIYFDVPSIINLVDI 553 LVR+ K + ++ NMQL + +LP Y + I DI Sbjct: 338 LVRKAKDEMMIEENMQLRVDLLPLWREKPYIKLQRIFETCDI 379 >02_05_0272 - 27348537-27348728,27349035-27349192,27349292-27349323, 27349420-27349514,27349614-27349687,27349800-27349878, 27350015-27350078,27350156-27350218,27350300-27350442, 27350566-27350703,27350792-27350913,27350993-27351158, 27351276-27351398,27351609-27351680,27351773-27351880, 27352481-27352597,27352727-27352865,27352974-27353080, 27353167-27353276,27353892-27354025,27354106-27354255, 27354329-27354549,27354647-27355318 Length = 1092 Score = 28.3 bits (60), Expect = 5.6 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 4/55 (7%) Frame = +2 Query: 383 PVDDKESEHREGFTALVREMKQALNV-KPN---MQLVISVLPNVNSSIYFDVPSI 535 P+ EH E AL ++A+N+ KP + L+I++LP+ N S+Y D+ I Sbjct: 660 PLVTARPEHVE--RALKARYQEAMNILKPQGGELDLLIAILPDNNGSLYGDLKRI 712 >08_02_0992 + 23380855-23381195,23382464-23382506,23383306-23383371, 23384228-23384428,23384450-23384707,23384798-23385013, 23385148-23385321,23386151-23386312,23386594-23386635 Length = 500 Score = 27.9 bits (59), Expect = 7.4 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 3/77 (3%) Frame = +2 Query: 17 LYKSAGIQADTYKMVSLNENLDIDRAHANYR-AITNLKRQFPQLRVFLTVGGDDDTE--D 187 L + Q Y+++S+NE D A YR AI N Q ++ V + E Sbjct: 3 LSSNISTQKTHYEVLSVNEGATYDEVRAGYRAAILNAHPDKSQAKLDSLVSSVEHGEFFS 62 Query: 188 PQKYNLLLESPQARTAF 238 QK +L P++RT + Sbjct: 63 VQKAWEVLRDPKSRTEY 79 >07_01_0465 + 3513296-3513631,3514386-3514442,3515196-3515306, 3515466-3515552,3515627-3515740,3515850-3516056, 3516291-3516428,3516691-3516852,3516939-3517138, 3517429-3517554,3517644-3517785 Length = 559 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 8/58 (13%) Frame = +2 Query: 392 DKESEHREGFT---ALV-----REMKQALNVKPNMQLVISVLPNVNSSIYFDVPSIIN 541 +KE+ H EGF+ ALV +E+++ L V+P + +++ + Y D+P +IN Sbjct: 139 EKEASHVEGFSPELALVTIGGGKELEEKLVVRPTSETIVNHMFTKWIQSYRDLPLMIN 196 >04_04_1630 - 34896021-34896143,34896329-34896403,34896500-34896556, 34897176-34897352,34897426-34897492,34898043-34898101, 34898188-34898241,34898455-34898604,34898709-34898918, 34898980-34899039,34899399-34899527,34899616-34899720, 34899935-34900024,34900630-34900695,34901047-34901115, 34901348-34901467,34901572-34901634,34901681-34901817, 34902070-34902160,34902298-34902463,34902700-34904172, 34905666-34905940,34906322-34906819,34906996-34907145, 34907840-34907911,34908006-34908266,34908478-34908558, 34908745-34908996,34909323-34909382,34909602-34909853, 34910385-34910549,34910589-34910849,34911267-34912307, 34913398-34913457,34914055-34914165,34914448-34914534, 34915227-34915300,34915397-34915490,34915644-34915689, 34916397-34916521 Length = 2501 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 77 LDIDRAHANYRAITNLKRQFPQLRVFL 157 + +D ANYRA+ L + FP ++ F+ Sbjct: 2373 ITLDTPGANYRAVWALSKYFPNVKTFV 2399 >04_04_1358 + 32869222-32869306,32869947-32870008,32870301-32870393, 32870640-32870761,32873139-32873167,32873586-32873891, 32873977-32874035,32874148-32874279,32874414-32874455, 32874560-32875093,32875189-32875379,32875538-32876027, 32876273-32876335,32876704-32876805,32876895-32877215, 32877294-32877386,32877484-32877585,32877718-32877822, 32877933-32878066,32878429-32878612,32879226-32879357, 32879447-32879559,32879628-32879709,32880328-32881992 Length = 1746 Score = 27.5 bits (58), Expect = 9.8 Identities = 18/74 (24%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = +2 Query: 212 ESPQARTAFTNSALLLAEQYGFDGIDLSWQLPKRKPKKIRSSIGSFW-HSIKKTFGTTPV 388 + P ++ N A L + D + +P P+ IR +GS W +++K Sbjct: 569 QCPTPQSHVDNHARKLVRKILEDSLMKLENMPANNPRTIRWELGSSWLQNLQKKDSPASE 628 Query: 389 DDKESEHREGFTAL 430 D K + H E T + Sbjct: 629 DKKNAGHVEKETTI 642 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,343,779 Number of Sequences: 37544 Number of extensions: 312099 Number of successful extensions: 875 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 875 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -