BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G12 (371 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces... 30 0.10 SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 27 0.94 SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizos... 26 1.6 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 26 2.2 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 25 2.9 SPBC11G11.07 ||SPBC18H10.01|karyopherin|Schizosaccharomyces pomb... 25 5.0 SPBC3E7.09 |||Sad1-UNC-like C-terminal|Schizosaccharomyces pombe... 25 5.0 SPCC74.04 |||amino acid permease, unknown 15|Schizosaccharomyces... 24 6.7 SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 24 6.7 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 24 6.7 SPBC119.11c |pac1|hcs|double-strand-specific ribonuclease Pac1|S... 24 6.7 SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schiz... 24 6.7 SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|S... 24 6.7 >SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces pombe|chr 1|||Manual Length = 576 Score = 30.3 bits (65), Expect = 0.10 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 96 NSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPI 203 N V DG + VVI P F+ P+N S N+ P+ Sbjct: 402 NHSVTGDGEAKQVVITMPSTHFT-PANNSSANHSPL 436 >SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 422 Score = 27.1 bits (57), Expect = 0.94 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +3 Query: 186 GNYEPI--STGPAFVDFNHPNYPPKRYDXPS-RPGG 284 G+Y P ST P + +P+YPP Y S RP G Sbjct: 117 GSYPPTQPSTQPLPQSYGYPSYPPAGYRGGSARPSG 152 >SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1338 Score = 26.2 bits (55), Expect = 1.6 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +3 Query: 129 HVVIANPDPFFSQPSNGPSGNY-EPISTGPAF-VDFNHPNYPPKRYDXPS 272 HV ++NPD P + S NY P+ A +F+ P + +Y P+ Sbjct: 478 HVSLSNPDFAIGSPMSQDSSNYSSPLHRRKASDSNFSDPRFDDLKYLSPN 527 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 25.8 bits (54), Expect = 2.2 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 4/29 (13%) Frame = +3 Query: 156 FFSQPSNGP----SGNYEPISTGPAFVDF 230 F + P+N P SG+Y PI P F F Sbjct: 1560 FVTPPTNSPYAEVSGDYNPIHVSPTFAAF 1588 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 25.4 bits (53), Expect = 2.9 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +3 Query: 162 SQPSNGPSGNYEPISTGPAFVDFNHPNYPP 251 S P N P P+S PA + P PP Sbjct: 265 SSPPNSPPRPIAPVSMNPAINSTSKPPLPP 294 >SPBC11G11.07 ||SPBC18H10.01|karyopherin|Schizosaccharomyces pombe|chr 2|||Manual Length = 955 Score = 24.6 bits (51), Expect = 5.0 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = -1 Query: 335 HFSKFKIAYLNGDNYLSPPGARGXVVSLGWIIGMIEIDERRSSAYGFI 192 H S+ + YLN YL+P L I+ + + S + F+ Sbjct: 549 HLSQLHMFYLNAKTYLAPDPLMEVAQGLAHIVDIQPVANVYQSVHSFL 596 >SPBC3E7.09 |||Sad1-UNC-like C-terminal|Schizosaccharomyces pombe|chr 2|||Manual Length = 659 Score = 24.6 bits (51), Expect = 5.0 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 120 CRPMEHHYCPPRELCLRQP 64 C P H+C LCL+ P Sbjct: 25 CSPQTSHWCKYPALCLKSP 43 >SPCC74.04 |||amino acid permease, unknown 15|Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 24.2 bits (50), Expect = 6.7 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +3 Query: 156 FFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRY 260 + +Q GPS NY + V+ +PNY + Y Sbjct: 151 YIAQLVGGPSINYSTAAMLLGAVNIGNPNYEVQNY 185 >SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 262 Score = 24.2 bits (50), Expect = 6.7 Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 171 SNGPSGNYEPISTGPAF--VDFNHPNYPPKRYDXPSRP 278 + G S P + PA D++ P+Y Y PS+P Sbjct: 71 AGGSSTGSTPRTASPAVGNQDYSKPSYSQPSYSQPSQP 108 Score = 23.8 bits (49), Expect = 8.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 108 PSDGNSDHVVIANPDPFFSQPSNGP 182 P+ GN D+ + P +SQPS P Sbjct: 85 PAVGNQDYSKPSYSQPSYSQPSQPP 109 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 24.2 bits (50), Expect = 6.7 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +3 Query: 111 SDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAF 221 SD DH V + P F S+ P + E S P F Sbjct: 1443 SDVEDDHDVAKSTAPDFETSSHRPERSSEKKSPSPVF 1479 >SPBC119.11c |pac1|hcs|double-strand-specific ribonuclease Pac1|Schizosaccharomyces pombe|chr 2|||Manual Length = 363 Score = 24.2 bits (50), Expect = 6.7 Identities = 9/34 (26%), Positives = 14/34 (41%) Frame = +3 Query: 150 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 251 +P +PS+ P + P +F YPP Sbjct: 99 EPVIEEPSSHPKNQKNQENNEPTSEEFEEGEYPP 132 >SPAC23E2.02 |lsd2|swm2, saf140|histone demethylase SWIRM2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1273 Score = 24.2 bits (50), Expect = 6.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 151 SGFAITTWSLLPSDGTPLL 95 S F + W++LP G P+L Sbjct: 899 SCFVLRIWNMLPETGVPIL 917 >SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|Schizosaccharomyces pombe|chr 3|||Manual Length = 624 Score = 24.2 bits (50), Expect = 6.7 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 131 RCYCEPGSFLLSTIKRS*RKL*THKHWTGVRR 226 +C EP S STI+ HW G+R+ Sbjct: 444 KCLTEPTSRFQSTIEIQKHPFFKRLHWNGLRK 475 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,619,703 Number of Sequences: 5004 Number of extensions: 31994 Number of successful extensions: 82 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 118158644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -