BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G12 (371 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0216 + 15804110-15804284,15804341-15804351 30 0.67 06_03_0795 - 24683023-24683155,24685853-24686057,24686275-246864... 30 0.67 07_03_1693 - 28756331-28756435,28756558-28756664,28757114-287572... 29 1.5 03_05_0517 - 25118232-25118730,25119002-25119273 29 1.5 07_03_0817 - 21735283-21735358,21735719-21735796,21735885-217359... 28 2.7 06_02_0155 + 12380452-12381012 27 3.6 04_04_1390 - 33184233-33184478,33184601-33184705,33184783-331848... 27 3.6 12_02_0219 + 15822050-15824896 27 4.7 09_02_0511 - 10079180-10079355,10079656-10079722,10080144-100801... 27 6.2 07_03_1160 - 24430240-24431268 27 6.2 07_03_0202 + 15131001-15131047,15131488-15131754,15131913-151319... 27 6.2 03_02_0260 - 6924532-6924757,6925443-6925546,6925729-6926007,692... 27 6.2 02_04_0273 + 21454795-21454925,21454962-21455193 27 6.2 01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 27 6.2 12_01_0014 + 105422-105520,105598-105725,105939-106101,106198-10... 26 8.2 07_01_0601 + 4464745-4465010,4465274-4466582 26 8.2 05_04_0011 + 17139322-17139451,17139552-17140174 26 8.2 03_02_0259 - 6920472-6920579,6920744-6921022,6921115-6921390,692... 26 8.2 02_05_0005 - 24890239-24891419,24891524-24891694,24891810-24892704 26 8.2 02_01_0138 + 999809-999821,1000456-1001341,1001424-1003221,10037... 26 8.2 >12_02_0216 + 15804110-15804284,15804341-15804351 Length = 61 Score = 29.9 bits (64), Expect = 0.67 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +3 Query: 99 SGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAF 221 SG P+ +H V FF+ SN SGNY + G F Sbjct: 12 SGSPAPPYKNHTVAGADGWFFNATSNTTSGNYSDWAAGETF 52 >06_03_0795 - 24683023-24683155,24685853-24686057,24686275-24686443, 24686590-24686775,24686916-24687124,24687197-24687362 Length = 355 Score = 29.9 bits (64), Expect = 0.67 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 126 HYCRPMEHHYCPPRELCLRQPW 61 HYCR +E+ YC + L R+ W Sbjct: 181 HYCRSIENWYCLSKTLAEREAW 202 >07_03_1693 - 28756331-28756435,28756558-28756664,28757114-28757245, 28757412-28757478,28757553-28757635,28757824-28757905, 28763101-28763177,28763278-28763361,28763443-28763512, 28763625-28763713,28763801-28764487,28765700-28765997 Length = 626 Score = 28.7 bits (61), Expect = 1.5 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -3 Query: 318 NCLS*WRQ-LPFPPRGERVXRIAWVDNWDD*NRRTPVQCLWVHNFR*DRLMVERR 157 N L WR+ LP P ERV W ++ D+ + +Q +V NFR ++E+R Sbjct: 171 NVLLDWRESLPHPD--ERVEYEFWTNSNDECGAKCDMQMNFVRNFRGTAQVLEKR 223 >03_05_0517 - 25118232-25118730,25119002-25119273 Length = 256 Score = 28.7 bits (61), Expect = 1.5 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = +3 Query: 150 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDXPS 272 D FF++ P GN T P VD P P + + S Sbjct: 37 DWFFTRKGESPQGNISKEETAPTGVDVTDPGRPGRAFTQDS 77 >07_03_0817 - 21735283-21735358,21735719-21735796,21735885-21735945, 21736038-21736069,21736144-21736221,21738046-21738213, 21738711-21738897,21740019-21740160 Length = 273 Score = 27.9 bits (59), Expect = 2.7 Identities = 18/47 (38%), Positives = 21/47 (44%) Frame = +3 Query: 147 PDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDXPSRPGGG 287 P PF S P G Y+PI GP V P + P R+ RP G Sbjct: 216 PVPFGGPGSVPPGGRYDPI--GPPDV----PGFEPSRFVRRPRPPAG 256 >06_02_0155 + 12380452-12381012 Length = 186 Score = 27.5 bits (58), Expect = 3.6 Identities = 17/70 (24%), Positives = 25/70 (35%) Frame = +3 Query: 108 PSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDXPSRPGGG 287 P+DG+ H +P P NG G P + P Y K+ P G Sbjct: 29 PNDGDGGHK--PSPPPHAGGAVNGNGGAAPPAPATSPDTEVRAPTYGDKQISPPKEGAAG 86 Query: 288 KVIVSIKISN 317 K + + +N Sbjct: 87 KPPMVVPAAN 96 >04_04_1390 - 33184233-33184478,33184601-33184705,33184783-33184890, 33184967-33185101,33185263-33185363,33185495-33185564, 33185642-33185758,33186001-33186138,33186371-33186439, 33186556-33186645,33186758-33186940,33187020-33187052 Length = 464 Score = 27.5 bits (58), Expect = 3.6 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 234 HPNYPPKRYDXPSRPGGGKVIVSIKISNFKLRKMV 338 HP Y K Y+ PS G KV+ KI+NF M+ Sbjct: 111 HPEYR-KNYNFPSYKEGWKVLREGKITNFMKSTML 144 >12_02_0219 + 15822050-15824896 Length = 948 Score = 27.1 bits (57), Expect = 4.7 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +1 Query: 1 DNSDTIRQ*KLSC-FSSSPYWPWLPQTEFTWWTIVV 105 D D +R+ ++ C F+ P WPWL ++ T+V+ Sbjct: 269 DFGDPLRKHEMHCRFTQGPPWPWLAVAS-SYGTLVI 303 >09_02_0511 - 10079180-10079355,10079656-10079722,10080144-10080181, 10080255-10080336 Length = 120 Score = 26.6 bits (56), Expect = 6.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 87 VVDNSGVPSDGNSDHVVIANPDPFFSQPSNG 179 +++N+G S GN ++ N PFF SNG Sbjct: 57 ILNNAGATSKGNYALILPVNEFPFFLVYSNG 87 >07_03_1160 - 24430240-24431268 Length = 342 Score = 26.6 bits (56), Expect = 6.2 Identities = 13/45 (28%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +3 Query: 147 PDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP-KRYDXPSRP 278 P P P P+ N P+ P +P+ PP + D P P Sbjct: 48 PPPLLPTPDVVPNPNQPPLQPTPGVPPLPNPDVPPMNKPDVPPMP 92 >07_03_0202 + 15131001-15131047,15131488-15131754,15131913-15131940, 15132120-15132179,15132570-15132696,15132907-15133724 Length = 448 Score = 26.6 bits (56), Expect = 6.2 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 4/57 (7%) Frame = +3 Query: 75 NRVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGP----SGNYEPISTGPAFVDFN 233 NR+HV+D + V I+ PDP +P + P S P + +F +FN Sbjct: 19 NRLHVLDPPCPSPVAAGEKVSISAPDPISHKPVSRPKVPVSDGNAPNAISKSFFNFN 75 >03_02_0260 - 6924532-6924757,6925443-6925546,6925729-6926007, 6926093-6926368,6926460-6926678,6926758-6926926, 6927208-6927382,6927489-6927600,6929566-6929820 Length = 604 Score = 26.6 bits (56), Expect = 6.2 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 87 VVDNSGVPSDGNSDHVVIANPDPFFSQP 170 V++N +P N HVV+ANP P P Sbjct: 248 VLENCQLPH-ANHGHVVLANPSPILFYP 274 >02_04_0273 + 21454795-21454925,21454962-21455193 Length = 120 Score = 26.6 bits (56), Expect = 6.2 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -1 Query: 275 ARGXVVSLGWIIGMIEIDE--RRSSAYGFIISAR 180 A G ++SLGW+ G + +D RS GF+ S R Sbjct: 7 AAGQLLSLGWVTGYMILDGFLDRSFLLGFLDSGR 40 >01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 Length = 580 Score = 26.6 bits (56), Expect = 6.2 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +3 Query: 99 SGVPSD-GNSDHVVIANPDPFF-SQPSNGPSGNYEPIST 209 SG PS GN+ + ++P PF S PS+G SGNY + T Sbjct: 464 SGSPSHRGNAG--MKSSPSPFAPSGPSSGGSGNYGRLPT 500 >12_01_0014 + 105422-105520,105598-105725,105939-106101,106198-106310, 106787-106825,107026-107109,107193-107241,107331-107422, 107680-107809,107906-107982,108058-109676,110024-110221, 110287-110825 Length = 1109 Score = 26.2 bits (55), Expect = 8.2 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 6/39 (15%) Frame = +3 Query: 153 PFFSQPSNGPSG------NYEPISTGPAFVDFNHPNYPP 251 P FS P+ P+G ++E ++ P F N PN PP Sbjct: 875 PGFSAPARVPTGFSSGFSSHEGLNPPPGFSSHNGPNPPP 913 >07_01_0601 + 4464745-4465010,4465274-4466582 Length = 524 Score = 26.2 bits (55), Expect = 8.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 123 SDHVVIANPDPFFSQPSNGPSGNYEPISTGPA 218 SDH V+ P PF P++ + + PI T PA Sbjct: 50 SDHFVLT-PPPFQITPTSIQNSTWLPIPTSPA 80 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 26.2 bits (55), Expect = 8.2 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 5/55 (9%) Frame = +3 Query: 147 PDPFFSQPSNGPS--GNYEPIS-TGPAFV--DFNHPNYPPKRYDXPSRPGGGKVI 296 P P P NG + GN + ++ TGP + +F P PP PS P GGKVI Sbjct: 69 PPPPPPSPPNGGNVIGNGKRLTPTGPDPIHNEFQPPPPPPP----PSPPNGGKVI 119 >03_02_0259 - 6920472-6920579,6920744-6921022,6921115-6921390, 6921473-6921691,6921795-6921963,6922248-6922422, 6922490-6922601,6923343-6923573 Length = 522 Score = 26.2 bits (55), Expect = 8.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 87 VVDNSGVPSDGNSDHVVIANPDPFFSQP 170 V++N +P N HV++ANP P P Sbjct: 240 VLENCQLPHP-NHGHVILANPSPILCYP 266 >02_05_0005 - 24890239-24891419,24891524-24891694,24891810-24892704 Length = 748 Score = 26.2 bits (55), Expect = 8.2 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = -1 Query: 326 KFKIAYLNGDNYLSPPGARGXVVSLGWIIGMIEIDERRSSAYGFIISAR 180 +F+ Y+ +++ G + +V L W++G E R +A G++ +R Sbjct: 219 EFRTTYVTTGDFVESTGGKVPLV-LDWVVGKKTCREARRNATGYMCVSR 266 >02_01_0138 + 999809-999821,1000456-1001341,1001424-1003221, 1003716-1003805,1004034-1004111,1004513-1004518, 1004849-1004958,1005174-1005369 Length = 1058 Score = 26.2 bits (55), Expect = 8.2 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 122 IAVRWNTTIVHHVNSV 75 IA RW T ++HHVNS+ Sbjct: 507 IAGRWLTQMLHHVNSL 522 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,256,274 Number of Sequences: 37544 Number of extensions: 237755 Number of successful extensions: 563 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 588739508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -