BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G12 (371 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37249| Best HMM Match : UDPGP (HMM E-Value=6.8e-18) 30 0.69 SB_41909| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.8 SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) 27 3.7 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 27 4.9 SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) 27 4.9 SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) 27 4.9 SB_49511| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.9 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 27 4.9 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 27 4.9 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.9 SB_8894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_4940| Best HMM Match : DUF755 (HMM E-Value=2.3) 27 6.4 SB_20719| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_10754| Best HMM Match : C2 (HMM E-Value=5.1e-40) 27 6.4 SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_35132| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 >SB_37249| Best HMM Match : UDPGP (HMM E-Value=6.8e-18) Length = 427 Score = 29.9 bits (64), Expect = 0.69 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = -1 Query: 329 SKFKIAYLNGDNYLSPPGA---RGXVVSLGWIIGMIEIDERRSSAYGFI 192 +KF +A + D+ SPP R ++S GWI+ IEI+ R S +I Sbjct: 119 NKFVLASQSIDHERSPPVPGIIRAQIMSSGWIVEPIEINGRECSMVWYI 167 >SB_41909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 27.9 bits (59), Expect = 2.8 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 6/54 (11%) Frame = +3 Query: 150 DPFFSQPSN---GPSGNYEPI---STGPAFVDFNHPNYPPKRYDXPSRPGGGKV 293 DPFF PS+ GPS P+ S G +F F+ + PP + SRP V Sbjct: 89 DPFFGPPSDGGFGPSDRGSPVPRPSCGSSF--FSERDPPPGKGSPGSRPNSSGV 140 >SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 790 Score = 27.5 bits (58), Expect = 3.7 Identities = 17/51 (33%), Positives = 21/51 (41%) Frame = +3 Query: 138 IANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDXPSRPGGGK 290 IAN P F + NY P+ G ++ P P D PSR G K Sbjct: 690 IANVVPIFKKGKRSSPNNYRPVVYGTVDIE-REPFLVP--MDRPSRNGNSK 737 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 27.1 bits (57), Expect = 4.9 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 135 VIANPDPFFSQP-SNGPSGNYEPISTG 212 VIA PDP S+P +NG G PIS+G Sbjct: 258 VIAEPDPCLSKPCANG--GTCSPISSG 282 >SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) Length = 318 Score = 27.1 bits (57), Expect = 4.9 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 135 VIANPDPFFSQP-SNGPSGNYEPISTG 212 VIA PDP S+P +NG G PIS+G Sbjct: 54 VIAEPDPCLSKPCANG--GTCSPISSG 78 >SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) Length = 228 Score = 27.1 bits (57), Expect = 4.9 Identities = 21/63 (33%), Positives = 28/63 (44%) Frame = +3 Query: 90 VDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDXP 269 VD+SGV D S +V A +P FSQ S G P+ P ++ + YD Sbjct: 161 VDSSGVAGDQRSSLLVSATLNPLFSQ-SLGSVSFGIPLIPSPTLPSTEKDSF--QEYDQL 217 Query: 270 SRP 278 S P Sbjct: 218 SPP 220 >SB_49511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.1 bits (57), Expect = 4.9 Identities = 21/63 (33%), Positives = 28/63 (44%) Frame = +3 Query: 90 VDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDXP 269 VD+SGV D S +V A +P FSQ S G P+ P ++ + YD Sbjct: 90 VDSSGVAGDQRSSLLVSATLNPLFSQ-SLGSVSFGIPLIPSPTLPSTEKDSF--QEYDQL 146 Query: 270 SRP 278 S P Sbjct: 147 SPP 149 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 27.1 bits (57), Expect = 4.9 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 135 VIANPDPFFSQP-SNGPSGNYEPISTG 212 VIA PDP S+P +NG G PIS+G Sbjct: 409 VIAEPDPCLSKPCANG--GTCSPISSG 433 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 27.1 bits (57), Expect = 4.9 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +3 Query: 162 SQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDXPSRP 278 S PS+ + P P++ + HP +P Y PS P Sbjct: 107 SYPSSHIQASLLPHIQHPSYPTYKHPPFPHPTYKHPSYP 145 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 27.1 bits (57), Expect = 4.9 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +3 Query: 147 PDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDXPSRP 278 P+P + P N P Y P P + +P YPP Y P P Sbjct: 128 PNPPYPPPPNAP---YPPSPNAP-YPPPPNPPYPPPLYPPPPNP 167 >SB_8894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 26.6 bits (56), Expect = 6.4 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 222 VDFNHPNYPPKRYD 263 VD NHPNY P+ Y+ Sbjct: 32 VDLNHPNYLPETYN 45 >SB_4940| Best HMM Match : DUF755 (HMM E-Value=2.3) Length = 173 Score = 26.6 bits (56), Expect = 6.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 119 AVRWNTTIVHHVNSVCGSHGQY 54 A RW T H+ +CG HG+Y Sbjct: 55 ATRWTTN--HNCYHICGHHGRY 74 >SB_20719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 26.6 bits (56), Expect = 6.4 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +3 Query: 105 VPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRY 260 +P DGN IAN D PSN P ++ + A V+ +PP Y Sbjct: 87 IPEDGNGCAAYIANVD-----PSNKPGSHWLAVYFTYANVNGESFRFPPHAY 133 >SB_10754| Best HMM Match : C2 (HMM E-Value=5.1e-40) Length = 2057 Score = 26.6 bits (56), Expect = 6.4 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +3 Query: 153 PFFSQPSNGPSGNYE--PISTGPAFVDFNHPNYPPKRYDXPS 272 P FS PS G Y+ P+ T P+ +Y P D PS Sbjct: 43 PLFSDPSMTRIGTYDYRPLFTDPSMTRIGTYDYRPLFTDDPS 84 >SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 26.6 bits (56), Expect = 6.4 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 129 GHYCRPMEHHYCPPRELCLR 70 GH C+P CPP C+R Sbjct: 805 GHQCQPDTCDSCPPNSHCMR 824 >SB_35132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 26.2 bits (55), Expect = 8.5 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +3 Query: 180 PSGNYEPISTGPAFVDFNHPNYPPKRYDXPSRPGGGKVIVSIK 308 PSG Y G +V+ PPK + ++PG K+ S++ Sbjct: 144 PSGTYYIELDGKLWVENKDSLQPPKMHPLRNKPGHFKLATSLR 186 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,328,094 Number of Sequences: 59808 Number of extensions: 259342 Number of successful extensions: 648 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 607387585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -