BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G12 (371 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70756-7|CAA94794.2| 199|Caenorhabditis elegans Hypothetical pr... 29 1.1 AL033536-4|CAA22144.2| 1582|Caenorhabditis elegans Hypothetical ... 29 1.1 Z70756-8|CAA94795.2| 212|Caenorhabditis elegans Hypothetical pr... 28 1.9 U41557-6|AAA83307.1| 589|Caenorhabditis elegans Collagen sequen... 27 4.3 AC006674-12|AAO38617.1| 357|Caenorhabditis elegans Hypothetical... 27 4.3 AL132864-1|CAB63392.1| 613|Caenorhabditis elegans Hypothetical ... 27 5.7 AF003141-14|AAM48549.1| 362|Caenorhabditis elegans Hypothetical... 27 5.7 AF003141-13|AAK21490.1| 549|Caenorhabditis elegans Hypothetical... 27 5.7 AF003386-6|AAK82897.1| 527|Caenorhabditis elegans Hypothetical ... 26 7.5 Z35602-1|CAA84669.1| 1469|Caenorhabditis elegans Hypothetical pr... 26 9.9 U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical pr... 26 9.9 L35274-1|AAA62647.1| 1469|Caenorhabditis elegans chromosome cond... 26 9.9 AF003386-2|AAB54255.1| 527|Caenorhabditis elegans Hypothetical ... 26 9.9 >Z70756-7|CAA94794.2| 199|Caenorhabditis elegans Hypothetical protein T06E4.8 protein. Length = 199 Score = 29.1 bits (62), Expect = 1.1 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +3 Query: 135 VIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 251 V A P P F+ P+ P PI GPAF P P Sbjct: 110 VFAAPRPVFASPALAPVAPMAPILRGPAFAYAPSPVLAP 148 >AL033536-4|CAA22144.2| 1582|Caenorhabditis elegans Hypothetical protein Y53C10A.10 protein. Length = 1582 Score = 29.1 bits (62), Expect = 1.1 Identities = 20/48 (41%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 144 NPDPFFSQPS-NGPSGNYEPISTGPAFVDFNHPNYPPKRYDXPSRPGG 284 NP P PS NGPS +P GP+ N P+ P K PS P G Sbjct: 939 NPGPGPGPPSPNGPSDPNKPSPNGPSPNGPNGPSDPNK--PGPSGPNG 984 >Z70756-8|CAA94795.2| 212|Caenorhabditis elegans Hypothetical protein T06E4.9 protein. Length = 212 Score = 28.3 bits (60), Expect = 1.9 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +3 Query: 135 VIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPP 251 V A P P F+ P+ P P+ GPAF P P Sbjct: 123 VFAAPRPVFAAPALAPVAPMAPVLRGPAFAYAPSPVLAP 161 >U41557-6|AAA83307.1| 589|Caenorhabditis elegans Collagen sequence x-hybridizingprotein 1 protein. Length = 589 Score = 27.1 bits (57), Expect = 4.3 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +3 Query: 93 DNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPA 218 D SG P G DP +QPS GP G + P P+ Sbjct: 291 DPSGAPPSGGPPGPF----DPSGAQPSGGPPGPFNPSGAPPS 328 >AC006674-12|AAO38617.1| 357|Caenorhabditis elegans Hypothetical protein K12H6.6b protein. Length = 357 Score = 27.1 bits (57), Expect = 4.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 123 YCRPMEHHYCPPRELCLRQPWP 58 +C P+++ Y P + L PWP Sbjct: 282 HCSPLQYPYSNPYSILLDAPWP 303 >AL132864-1|CAB63392.1| 613|Caenorhabditis elegans Hypothetical protein Y53H1A.1 protein. Length = 613 Score = 26.6 bits (56), Expect = 5.7 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +3 Query: 177 GPSGNYEPISTGPAFVDFNHPNYPPKRYDXPSRP 278 GP ++ P P F P+ PP+ Y P RP Sbjct: 131 GPPQHFPPGPPRPHFPGPPGPHRPPEHYPGPPRP 164 >AF003141-14|AAM48549.1| 362|Caenorhabditis elegans Hypothetical protein W02D3.11b protein. Length = 362 Score = 26.6 bits (56), Expect = 5.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 147 PDPFFSQPSNGPSGNYEPIS 206 P PF S P P G Y+P S Sbjct: 219 PPPFASAPQTAPRGAYDPYS 238 >AF003141-13|AAK21490.1| 549|Caenorhabditis elegans Hypothetical protein W02D3.11a protein. Length = 549 Score = 26.6 bits (56), Expect = 5.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 147 PDPFFSQPSNGPSGNYEPIS 206 P PF S P P G Y+P S Sbjct: 219 PPPFASAPQTAPRGAYDPYS 238 >AF003386-6|AAK82897.1| 527|Caenorhabditis elegans Hypothetical protein F59E12.4a protein. Length = 527 Score = 26.2 bits (55), Expect = 7.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 117 GNSDHVVIANPDPFFSQPSNGPSG 188 GN D VI N DPF S G G Sbjct: 476 GNDDIPVIPNGDPFSGSSSGGSGG 499 >Z35602-1|CAA84669.1| 1469|Caenorhabditis elegans Hypothetical protein R13G10.1 protein. Length = 1469 Score = 25.8 bits (54), Expect = 9.9 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +3 Query: 225 DFNHPNYPPKRYDXPSRPGGGK-VIVSIKISNFK 323 D + PPK D S P G + +I++I + NFK Sbjct: 69 DLLNVQIPPKYEDQISDPDGNRMIILNIYVENFK 102 >U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical protein B0280.13 protein. Length = 616 Score = 25.8 bits (54), Expect = 9.9 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +3 Query: 138 IANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDXPSR 275 +A P P PS P+ + PISTGP++ P P PSR Sbjct: 439 VAPPPP----PSAPPTIKF-PISTGPSYSSTTPPTTPKPAPPPPSR 479 >L35274-1|AAA62647.1| 1469|Caenorhabditis elegans chromosome condensation protein protein. Length = 1469 Score = 25.8 bits (54), Expect = 9.9 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +3 Query: 225 DFNHPNYPPKRYDXPSRPGGGK-VIVSIKISNFK 323 D + PPK D S P G + +I++I + NFK Sbjct: 69 DLLNVQIPPKYEDQISDPDGNRMIILNIYVENFK 102 >AF003386-2|AAB54255.1| 527|Caenorhabditis elegans Hypothetical protein F59E12.5a protein. Length = 527 Score = 25.8 bits (54), Expect = 9.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 117 GNSDHVVIANPDPFFSQPSNGPSG 188 GN D VI N DPF S G G Sbjct: 476 GNDDIPVIPNGDPFSGSSSGGSRG 499 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,258,114 Number of Sequences: 27780 Number of extensions: 197239 Number of successful extensions: 547 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 535612900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -