BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G10 (530 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z98877-4|CAB54473.2| 796|Caenorhabditis elegans Hypothetical pr... 25 0.67 Z98877-5|CAD56616.1| 731|Caenorhabditis elegans Hypothetical pr... 25 0.67 U88176-2|AAO91740.3| 550|Caenorhabditis elegans Hypothetical pr... 30 1.2 Z82078-9|CAE11308.1| 949|Caenorhabditis elegans Hypothetical pr... 29 2.7 Z82078-8|CAB04948.2| 947|Caenorhabditis elegans Hypothetical pr... 29 2.7 AL023844-13|CAE11312.1| 949|Caenorhabditis elegans Hypothetical... 29 2.7 AL023844-12|CAA19535.2| 947|Caenorhabditis elegans Hypothetical... 29 2.7 U28928-7|AAA68339.1| 665|Caenorhabditis elegans Peroxisomal mem... 28 3.6 AF047657-7|AAK18943.1| 424|Caenorhabditis elegans Hypothetical ... 28 4.8 Z69716-4|CAA93528.1| 480|Caenorhabditis elegans Hypothetical pr... 27 8.4 >Z98877-4|CAB54473.2| 796|Caenorhabditis elegans Hypothetical protein Y69H2.3b protein. Length = 796 Score = 25.0 bits (52), Expect(2) = 0.67 Identities = 10/30 (33%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +1 Query: 301 CATLKCSCGMNPSRTVIGLRSA-CPMEMRC 387 CAT++CS G ++ A CP C Sbjct: 381 CATMRCSAGTTCQEALVKCAKAPCPSHAAC 410 Score = 24.2 bits (50), Expect(2) = 0.67 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 283 NVYHTKCATLKCSCG 327 N+ T C+T+KCS G Sbjct: 335 NIQITPCSTMKCSAG 349 >Z98877-5|CAD56616.1| 731|Caenorhabditis elegans Hypothetical protein Y69H2.3c protein. Length = 731 Score = 25.0 bits (52), Expect(2) = 0.67 Identities = 10/30 (33%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +1 Query: 301 CATLKCSCGMNPSRTVIGLRSA-CPMEMRC 387 CAT++CS G ++ A CP C Sbjct: 316 CATMRCSAGTTCQEALVKCAKAPCPSHAAC 345 Score = 24.2 bits (50), Expect(2) = 0.67 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 283 NVYHTKCATLKCSCG 327 N+ T C+T+KCS G Sbjct: 270 NIQITPCSTMKCSAG 284 >U88176-2|AAO91740.3| 550|Caenorhabditis elegans Hypothetical protein F18F11.4 protein. Length = 550 Score = 29.9 bits (64), Expect = 1.2 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 4/78 (5%) Frame = +3 Query: 63 MVVIDWRKGVRRSLSEDDKYSYFTEDVDLNTYMYYLHMN--YPYWMTDEVYGLNKERQGE 236 +V D R LSED + + T ++ + +YYLH+ + + V N Sbjct: 384 VVHFDMHSVYRNELSEDKTHQHTTIEIYDSLNLYYLHLRRFERHLLNPPVVKYNNRFNSS 443 Query: 237 ILMYANSQLLARL--RME 284 +LM N+++L + RME Sbjct: 444 LLMKLNTKMLDQFTERME 461 >Z82078-9|CAE11308.1| 949|Caenorhabditis elegans Hypothetical protein Y48A6B.11b protein. Length = 949 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +3 Query: 72 IDWRKGVRRSLSEDDKYSYFTEDVDLNTY-MYYLHMNYPYWMTDEVYGLNKERQGEILM 245 +D+R VRR L + +K Y + V + Y + N +EVY KE+ G++++ Sbjct: 881 LDYRYDVRRGLPDAEKQKYQWQQVQMTVIAARYANKNL-INEANEVYATEKEKLGQMVL 938 >Z82078-8|CAB04948.2| 947|Caenorhabditis elegans Hypothetical protein Y48A6B.11a protein. Length = 947 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +3 Query: 72 IDWRKGVRRSLSEDDKYSYFTEDVDLNTY-MYYLHMNYPYWMTDEVYGLNKERQGEILM 245 +D+R VRR L + +K Y + V + Y + N +EVY KE+ G++++ Sbjct: 879 LDYRYDVRRGLPDAEKQKYQWQQVQMTVIAARYANKNL-INEANEVYATEKEKLGQMVL 936 >AL023844-13|CAE11312.1| 949|Caenorhabditis elegans Hypothetical protein Y48A6B.11b protein. Length = 949 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +3 Query: 72 IDWRKGVRRSLSEDDKYSYFTEDVDLNTY-MYYLHMNYPYWMTDEVYGLNKERQGEILM 245 +D+R VRR L + +K Y + V + Y + N +EVY KE+ G++++ Sbjct: 881 LDYRYDVRRGLPDAEKQKYQWQQVQMTVIAARYANKNL-INEANEVYATEKEKLGQMVL 938 >AL023844-12|CAA19535.2| 947|Caenorhabditis elegans Hypothetical protein Y48A6B.11a protein. Length = 947 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +3 Query: 72 IDWRKGVRRSLSEDDKYSYFTEDVDLNTY-MYYLHMNYPYWMTDEVYGLNKERQGEILM 245 +D+R VRR L + +K Y + V + Y + N +EVY KE+ G++++ Sbjct: 879 LDYRYDVRRGLPDAEKQKYQWQQVQMTVIAARYANKNL-INEANEVYATEKEKLGQMVL 936 >U28928-7|AAA68339.1| 665|Caenorhabditis elegans Peroxisomal membrane protein relatedprotein 1 protein. Length = 665 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 390 VRQNNFVPVTSENLKLKMLLD-DVEQMIREGILTGKIERRDG 512 +R P TS ++K+K + D D+EQM+ LT +ER G Sbjct: 525 LRDQVIYPDTSFDMKMKGMSDKDLEQMLENVQLTNILEREGG 566 >AF047657-7|AAK18943.1| 424|Caenorhabditis elegans Hypothetical protein F37B4.7 protein. Length = 424 Score = 27.9 bits (59), Expect = 4.8 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +3 Query: 72 IDWRKGVRRSLSEDDKYSYFTEDVDLNTYMYYLHM 176 ++W++ + L +++ E VD ++YM YL M Sbjct: 183 VEWKEAYEKKLEDNNVQGNLKEIVDQSSYMDYLRM 217 >Z69716-4|CAA93528.1| 480|Caenorhabditis elegans Hypothetical protein C04B4.4 protein. Length = 480 Score = 27.1 bits (57), Expect = 8.4 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 279 MERLSHKMCDIKMFMWNEPVKNGYWPKIRLPNGDEMPVRQNNFVP 413 ++ S+KM D+K F N+P K+ + + G PV+ N P Sbjct: 392 LKMTSNKMLDLKGFSMNDPPKSRFAIANQNSEGRASPVQPKNTNP 436 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,128,701 Number of Sequences: 27780 Number of extensions: 219271 Number of successful extensions: 613 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1049512662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -