BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G10 (530 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g17180.1 68416.m02191 serine carboxypeptidase S10 family prot... 31 0.37 At5g15830.1 68418.m01852 bZIP transcription factor family protei... 28 3.4 At2g06820.1 68415.m00761 expressed protein low similarity to zin... 27 6.0 At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:... 27 6.0 At5g33210.1 68418.m03923 zinc finger protein-related similar to ... 27 7.9 At4g28715.1 68417.m04107 myosin heavy chain, putative similar to... 27 7.9 At3g51060.1 68416.m05591 zinc finger protein, putative / lateral... 27 7.9 >At3g17180.1 68416.m02191 serine carboxypeptidase S10 family protein similar to serine carboxypeptidase II SP:P08819 [Triticum aestivum] (Carlsberg Res. Commun. 52:297-311(1987)) Length = 478 Score = 31.5 bits (68), Expect = 0.37 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = +3 Query: 30 NYYGIKVTDKSMVVIDWRKGVRRSLSEDDKYSYFTED----VDLNTYMYYLHMNYPYW 191 +Y G V DKS V DW K VR D YS + E+ VD+ ++ N W Sbjct: 301 SYLGFGVNDKSPAVKDWFKRVRWFEGYDPCYSNYAEEYFNRVDVRLSLHATTRNVARW 358 >At5g15830.1 68418.m01852 bZIP transcription factor family protein similar to common plant regulatory factor 7 GI:9650828 from [Petroselinum crispum]; contains Pfam profile: PF00170 bZIP transcription factor Length = 186 Score = 28.3 bits (60), Expect = 3.4 Identities = 17/92 (18%), Positives = 48/92 (52%), Gaps = 1/92 (1%) Frame = +3 Query: 195 TDEVYGLNKERQGEILMYANSQLLARLRMERLSHKMCDIKMFMWNEPVKNGYWPKI-RLP 371 T+E++ +N+ +Q M +N + R RM + H + W + K+ ++ Sbjct: 65 TEEIFVINERKQRR--MVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLDKLNQVS 122 Query: 372 NGDEMPVRQNNFVPVTSENLKLKMLLDDVEQM 467 + +++ +++N+ + ENL+L+ ++ ++++ Sbjct: 123 DNNDLVIQENS--SLKEENLELRQVITSMKKL 152 >At2g06820.1 68415.m00761 expressed protein low similarity to zinc finger protein [Arabidopsis thaliana] GI:976277 Length = 267 Score = 27.5 bits (58), Expect = 6.0 Identities = 10/24 (41%), Positives = 20/24 (83%) Frame = +3 Query: 414 VTSENLKLKMLLDDVEQMIREGIL 485 +TS ++K+K+LLD ++ +I+E I+ Sbjct: 151 ITSSSVKIKVLLDGLQPLIKETIV 174 >At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:499047) [Arabidopsis thaliana] Length = 1730 Score = 27.5 bits (58), Expect = 6.0 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +3 Query: 378 DEMPV-RQNNFVPVTSENLKLKMLLDDVEQMIRE 476 DE+PV Q+ + + +EN KLK L+ +E+ I E Sbjct: 1037 DEVPVIDQSAIIKLETENQKLKALVSSMEEKIDE 1070 >At5g33210.1 68418.m03923 zinc finger protein-related similar to lateral root primordium 1 (LRP1) [Arabidopsis thaliana] GI:882341; contains Pfam profile PF05142: Domain of unknown function (DUF702), TIGR01623: putative zinc finger domain, LRP1 type Length = 173 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 354 PKIRLPNGDEMPVRQNNFVPVTSENL 431 P+ +LP G+ +P R +P TS +L Sbjct: 105 PQTQLPRGESVPKRHRENLPATSSSL 130 >At4g28715.1 68417.m04107 myosin heavy chain, putative similar to myosin [Arabidopsis thaliana] gi|499047|emb|CAA84066 Length = 639 Score = 27.1 bits (57), Expect = 7.9 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 366 LPNGDEMPVRQNNFVP-VTSENLKLKMLLDDVEQMIRE 476 +P E+PV V +TSEN KLK L+ ++Q I E Sbjct: 87 VPVLQEVPVVDTELVEKLTSENEKLKSLVSSLDQKIDE 124 >At3g51060.1 68416.m05591 zinc finger protein, putative / lateral root primordium (LRP) protein-related similar to lateral root primordium 1 (LRP1) [Arabidopsis thaliana] GI:882341; contains Pfam profile PF05142: Domain of unknown function (DUF702) Length = 252 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 354 PKIRLPNGDEMPVRQNNFVPVTSENL 431 P+ +LP G+ +P R +P TS +L Sbjct: 197 PQTQLPRGESVPKRHRENLPATSSSL 222 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,414,228 Number of Sequences: 28952 Number of extensions: 197447 Number of successful extensions: 525 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 524 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 987020800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -