BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G05 (498 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.44 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 3.1 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 3.1 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 9.4 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.0 bits (52), Expect = 0.44 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 Query: 341 SIRTKRQTCGVCKSSLRT*LPR*CRQSVTDYKSRG 237 S+R+K +C++S RT +PR + S D RG Sbjct: 1322 SMRSKALIDQLCRNSRRTPVPRLAQDSSEDESYRG 1356 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 3.1 Identities = 13/45 (28%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 155 KNGSRDYGLFQINDKYWCSTGSTPGKDCHVTC-NQLLTDDISVAA 286 K Y + + DKY +G CH C +L D + +AA Sbjct: 454 KKNPNVYKVETVGDKYMAVSGLPEPCRCHARCIARLALDMMDLAA 498 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 3.1 Identities = 13/45 (28%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 155 KNGSRDYGLFQINDKYWCSTGSTPGKDCHVTC-NQLLTDDISVAA 286 K Y + + DKY +G CH C +L D + +AA Sbjct: 454 KKNPNVYKVETVGDKYMAVSGLPEPCRCHARCIARLALDMMDLAA 498 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -1 Query: 495 FKHKYNA*YPYKHFGFKLQLELVNFI 418 +K+ YN Y Y + + +L N+I Sbjct: 96 YKYNYNNKYNYNNNNYNKKLYYKNYI 121 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,639 Number of Sequences: 438 Number of extensions: 2700 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -