BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G04 (551 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 23 2.1 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 4.8 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 6.3 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 8.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 8.3 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 8.3 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 23.0 bits (47), Expect = 2.1 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 Query: 47 FYKTELKSVDFLNTEVAANEINSWV 121 FY+ E DF+ T + N I+ W+ Sbjct: 258 FYEVEGIGYDFIPTVLDRNVIDKWI 282 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 472 VHFNTEVAQAI*NARQTRQRVRNNDI 395 + N +AQ I +A+ T RNND+ Sbjct: 411 MEINQNIAQNIDHAKNTIIDYRNNDL 436 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 6.3 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +2 Query: 428 PRVLNSLSDLRVEMNNLRERL 490 P++++SLS+ + NN ++L Sbjct: 312 PKIISSLSNNTIHNNNYNKKL 332 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -1 Query: 158 RPIWVSFPV 132 RPIW +FP+ Sbjct: 310 RPIWSNFPI 318 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -1 Query: 158 RPIWVSFPV 132 RPIW +FP+ Sbjct: 310 RPIWSNFPI 318 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +2 Query: 26 FAAIAQEFYKTELKSVDFLNTEVAANEINS 115 F + + YK E + + TE +N +NS Sbjct: 78 FGIVYKALYKGEQVAAKIIQTEKYSNMLNS 107 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,689 Number of Sequences: 438 Number of extensions: 3610 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15827139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -