BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G03 (576 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36805| Best HMM Match : GED (HMM E-Value=0.24) 30 1.2 SB_53811| Best HMM Match : Mab-21 (HMM E-Value=0.003) 30 1.6 SB_17137| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_59317| Best HMM Match : APT (HMM E-Value=7.8) 28 4.8 SB_29242| Best HMM Match : CIDE-N (HMM E-Value=5) 28 4.8 SB_26513| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_10875| Best HMM Match : TIL (HMM E-Value=6.8) 28 6.3 SB_54209| Best HMM Match : Baculo_11_kDa (HMM E-Value=8) 27 8.3 SB_43399| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_12043| Best HMM Match : RVT_1 (HMM E-Value=3.1) 27 8.3 SB_51779| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) 27 8.3 >SB_36805| Best HMM Match : GED (HMM E-Value=0.24) Length = 377 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +2 Query: 134 QDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRIGYLPKYY 283 + V QV + ++ K G+ +D +I+N ++K V +LK Y KYY Sbjct: 49 EGVGQVVIHRKFMKPGELFDFPVSIENGKSRKFVSNWLKKYPWLAYSKYY 98 >SB_53811| Best HMM Match : Mab-21 (HMM E-Value=0.003) Length = 700 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +3 Query: 411 DSSCTHIILQLSSAMILMDSFYQLLMKFIHNSSLIWTLYLRIIRTKMQDGILH 569 D C HI+L++ M+ +S + + H + T +LR+I+TK G H Sbjct: 223 DGGCRHILLRIVKTMVRNESALKGELSSYH----LKTAFLRLIKTKDSPGYWH 271 >SB_17137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 80 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKA-VEEF 244 KD D V +QK VL + + + +++ K+ +DY VE ++ KK V +F Sbjct: 401 KDADIAPVPKQKPVLDINKHLRPISLTPVLSKLAEDYIVEQHLKPAVLKKVDVNQF 456 >SB_59317| Best HMM Match : APT (HMM E-Value=7.8) Length = 229 Score = 28.3 bits (60), Expect = 4.8 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 80 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKA-VEEF 244 KD D V +QK VL + + + +++ K+ +DY VE ++ KK V +F Sbjct: 35 KDADIAPVPKQKPVLDVNKHLRPISLTPVLSKLAEDYVVEQHLKPAVLKKVDVNQF 90 >SB_29242| Best HMM Match : CIDE-N (HMM E-Value=5) Length = 279 Score = 28.3 bits (60), Expect = 4.8 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 80 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKA-VEEF 244 KD D V +QK VL + + + +++ K+ +DY VE ++ KK V +F Sbjct: 108 KDADIAPVPKQKPVLDVNKHLRPISLTPVLSKLAEDYVVEQHLKPAVLKKVDVNQF 163 >SB_26513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1460 Score = 28.3 bits (60), Expect = 4.8 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +2 Query: 113 KKVLSLFQDVDQVNVDDEYYKIGKDY-DVEAN-IDNYTNKKAVEEFLKLYRI 262 ++ +SLF+DVD+ D+ Y KI Y D+ + ID Y + F KL ++ Sbjct: 93 ERCISLFKDVDKYKHDERYLKIWIQYADLCTDPIDVYDYMHSQSMFSKLAKL 144 >SB_10875| Best HMM Match : TIL (HMM E-Value=6.8) Length = 62 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 43 QCGVTENVSLQDKRCRRSVCG 105 +C + +NV D+ CRRS CG Sbjct: 29 KCHMEKNVIFDDRACRRSRCG 49 >SB_54209| Best HMM Match : Baculo_11_kDa (HMM E-Value=8) Length = 337 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = +2 Query: 122 LSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRIGYLPKYY 283 ++ + D++ + +K G+ +D +I+N ++K V +LK Y KYY Sbjct: 24 IASYSPQDKLKFIENVWKPGELFDFRVSIENGKSRKFVLNWLKKYPWLAYSKYY 77 >SB_43399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 27.5 bits (58), Expect = 8.3 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 80 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKA-VEEF 244 KD D V +QK VL + + + +++ K+ +DY VE ++ KK V +F Sbjct: 681 KDADIAPVPKQKPVLDVNKHLWPISLTPVLSKLAEDYVVEQHLKPAVLKKVDVNQF 736 >SB_12043| Best HMM Match : RVT_1 (HMM E-Value=3.1) Length = 602 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +2 Query: 80 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKK 229 KD D V +QK +L + + + +++ K+ +DY VE ++ KK Sbjct: 347 KDADIAPVPKQKPILDVNKHLRPISLTPVLSKLAEDYVVEQHLKPAVLKK 396 >SB_51779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3610 Score = 27.5 bits (58), Expect = 8.3 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = +2 Query: 17 AGLIALVQSSVVSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGK 184 +G+I L + + V+ Y+FK K D +F +L + +DQ N ++ G+ Sbjct: 1370 SGIITLSREAPVNVWEYNFKVKATDGIFTATTDVLLDI---IDQNNHKPQFTNCGE 1422 >SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) Length = 773 Score = 27.5 bits (58), Expect = 8.3 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 80 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKA-VEEF 244 KD D V +QK VL + + + +++ K+ +DY VE ++ KK V +F Sbjct: 392 KDADIAPVPKQKPVLDVNKHLWPISLTPVLSKLAEDYVVEQHLKPAVLKKVDVNQF 447 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,213,068 Number of Sequences: 59808 Number of extensions: 350691 Number of successful extensions: 1640 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1639 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -