SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0003_G02
         (441 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    24   0.74 
X06905-1|CAA30009.1|  489|Tribolium castaneum protein ( Triboliu...    21   6.9  
U04271-2|AAA03709.1|  490|Tribolium castaneum alpha-amylase II p...    21   6.9  
U04271-1|AAA03708.1|  490|Tribolium castaneum alpha-amylase I pr...    21   6.9  
EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine hydroxy...    21   6.9  
AJ518941-1|CAD57735.1|  456|Tribolium castaneum homothorax protein.    21   6.9  

>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 23.8 bits (49), Expect = 0.74
 Identities = 13/37 (35%), Positives = 15/37 (40%)
 Frame = +2

Query: 119 PGQVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFN 229
           P Q  I NP P  + PSN  +      S  P   D N
Sbjct: 411 PMQSQIINPQPQITSPSNTNTSTSSTNSNKPNSSDLN 447


>X06905-1|CAA30009.1|  489|Tribolium castaneum protein ( Tribolium
           castaneum mRNAfor alhpa amylase 3'region. ).
          Length = 489

 Score = 20.6 bits (41), Expect = 6.9
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = +1

Query: 253 IRQPSRPWWE 282
           +   +RPWWE
Sbjct: 67  VTSSNRPWWE 76


>U04271-2|AAA03709.1|  490|Tribolium castaneum alpha-amylase II
           protein.
          Length = 490

 Score = 20.6 bits (41), Expect = 6.9
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = +1

Query: 253 IRQPSRPWWE 282
           +   +RPWWE
Sbjct: 68  VTSSNRPWWE 77


>U04271-1|AAA03708.1|  490|Tribolium castaneum alpha-amylase I
           protein.
          Length = 490

 Score = 20.6 bits (41), Expect = 6.9
 Identities = 5/10 (50%), Positives = 7/10 (70%)
 Frame = +1

Query: 253 IRQPSRPWWE 282
           +   +RPWWE
Sbjct: 68  VTSSNRPWWE 77


>EF592178-1|ABQ95974.1|  532|Tribolium castaneum tyrosine
           hydroxylase protein.
          Length = 532

 Score = 20.6 bits (41), Expect = 6.9
 Identities = 6/13 (46%), Positives = 8/13 (61%)
 Frame = +2

Query: 218 VDFNHPNYPPKRY 256
           +D NHP +  K Y
Sbjct: 217 LDMNHPGFADKEY 229


>AJ518941-1|CAD57735.1|  456|Tribolium castaneum homothorax protein.
          Length = 456

 Score = 20.6 bits (41), Expect = 6.9
 Identities = 8/14 (57%), Positives = 8/14 (57%)
 Frame = +2

Query: 164 PSNGPSGNYEPIST 205
           P  GPSG Y P  T
Sbjct: 407 PHAGPSGAYSPDGT 420


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 93,655
Number of Sequences: 336
Number of extensions: 1936
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used:  9880622
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -