BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_G01 (512 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) 57 1e-08 SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) 51 5e-07 SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) 49 3e-06 SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 49 3e-06 SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 49 3e-06 SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) 49 3e-06 SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) 47 1e-05 SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) 42 3e-04 SB_6186| Best HMM Match : HSP20 (HMM E-Value=1.1e-06) 37 0.011 SB_3533| Best HMM Match : Pentapeptide (HMM E-Value=5.7) 31 0.74 SB_19678| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_16018| Best HMM Match : Antimicrobial18 (HMM E-Value=0.89) 30 1.3 SB_51290| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_33020| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_22269| Best HMM Match : Metallothionein (HMM E-Value=0.89) 29 3.0 SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) 28 5.2 SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 28 5.2 SB_48483| Best HMM Match : SH3_1 (HMM E-Value=7.1e-23) 27 6.9 SB_29219| Best HMM Match : 7tm_1 (HMM E-Value=9.8e-06) 27 6.9 SB_13470| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_19101| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) 27 6.9 SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 9.1 SB_44362| Best HMM Match : Transposase_24 (HMM E-Value=6.3) 27 9.1 SB_28946| Best HMM Match : Occludin_ELL (HMM E-Value=0.27) 27 9.1 SB_6803| Best HMM Match : 7tm_1 (HMM E-Value=4.3) 27 9.1 >SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) Length = 185 Score = 56.8 bits (131), Expect = 1e-08 Identities = 32/86 (37%), Positives = 47/86 (54%), Gaps = 3/86 (3%) Frame = +3 Query: 96 DGKTLKLRFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPE 275 D L DVS + PEE+ VK ++L V A+ E + R++NR F+LP+ + + Sbjct: 96 DDTKFTLALDVSDFKPEEVDVKVYGHELSVRARQECEEHGFFTARQFNRHFVLPREVDMD 155 Query: 276 AIKSSLSRDGVLTVEA---PLPQLAI 344 + L +DGVL +EA PL QL I Sbjct: 156 TLVPRLGKDGVLYIEADKRPLRQLDI 181 Score = 46.4 bits (105), Expect = 1e-05 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 1/92 (1%) Frame = +3 Query: 123 DVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKSSLSRD 302 DV ++ PEEI K + K+ V +S+ +E+ R + LP+G + +I + ++ D Sbjct: 12 DVREFKPEEITCKVENGKIKVSGLQRHESEEGFDSKEFRRCYNLPEGVDESSISTRIAED 71 Query: 303 GVLTVEA-PLPQLAITDRNIPIQKH*VEFHTA 395 G+L VEA A T+ P K +F A Sbjct: 72 GMLHVEALKKSPPATTENKAPATKDDTKFTLA 103 >SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) Length = 189 Score = 51.2 bits (117), Expect = 5e-07 Identities = 26/74 (35%), Positives = 42/74 (56%), Gaps = 1/74 (1%) Frame = +3 Query: 105 TLKL-RFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAI 281 TL++ + DV +Y PEEI K + + V +H + + +E+ R F LP+G +PE + Sbjct: 6 TLEIAKLDVKEYRPEEISFKVENGVVKVQGRHVNEGEFGFELKEFRRTFTLPEGIDPENV 65 Query: 282 KSSLSRDGVLTVEA 323 S +S G L +EA Sbjct: 66 TSRISNHGHLHIEA 79 Score = 47.6 bits (108), Expect = 6e-06 Identities = 22/70 (31%), Positives = 42/70 (60%) Frame = +3 Query: 114 LRFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKSSL 293 + DV+ + PE I V+ + +LLV+A HE + + +NR+F+LP+ + +++ + L Sbjct: 100 MAIDVAGFPPESIKVQVLGNELLVNANHEVEHEGHYHAMHFNRQFVLPREVDMDSLTTRL 159 Query: 294 SRDGVLTVEA 323 ++G L EA Sbjct: 160 DKEGKLHFEA 169 >SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) Length = 424 Score = 48.8 bits (111), Expect = 3e-06 Identities = 24/80 (30%), Positives = 46/80 (57%) Frame = +3 Query: 84 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKG 263 + +GD K + DV+ + P+ I V+ + +LLV A HE + + +NR+F+LP+ Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 150 Query: 264 TNPEAIKSSLSRDGVLTVEA 323 + +++ + L ++G L EA Sbjct: 151 VDMDSLTTRLDKEGKLHFEA 170 Score = 48.8 bits (111), Expect = 3e-06 Identities = 24/80 (30%), Positives = 46/80 (57%) Frame = +3 Query: 84 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKG 263 + +GD K + DV+ + P+ I V+ + +LLV A HE + + +NR+F+LP+ Sbjct: 326 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 384 Query: 264 TNPEAIKSSLSRDGVLTVEA 323 + +++ + L ++G L EA Sbjct: 385 VDMDSLTTRLDKEGKLHFEA 404 Score = 45.2 bits (102), Expect = 3e-05 Identities = 22/69 (31%), Positives = 35/69 (50%) Frame = +3 Query: 117 RFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKSSLS 296 + DV +Y PEEI K + + V +H + +E+ R F LP+G +K+ +S Sbjct: 11 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFTLPEGVEASNVKTRIS 70 Query: 297 RDGVLTVEA 323 G L +EA Sbjct: 71 NHGQLHIEA 79 Score = 45.2 bits (102), Expect = 3e-05 Identities = 22/69 (31%), Positives = 35/69 (50%) Frame = +3 Query: 117 RFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKSSLS 296 + DV +Y PEEI K + + V +H + +E+ R F LP+G +K+ +S Sbjct: 245 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFTLPEGVEASNVKTRIS 304 Query: 297 RDGVLTVEA 323 G L +EA Sbjct: 305 NHGQLHIEA 313 >SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 48.8 bits (111), Expect = 3e-06 Identities = 24/80 (30%), Positives = 46/80 (57%) Frame = +3 Query: 84 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKG 263 + +GD K + DV+ + P+ I V+ + +LLV A HE + + +NR+F+LP+ Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 150 Query: 264 TNPEAIKSSLSRDGVLTVEA 323 + +++ + L ++G L EA Sbjct: 151 VDMDSLTTRLDKEGKLHFEA 170 Score = 45.2 bits (102), Expect = 3e-05 Identities = 22/69 (31%), Positives = 35/69 (50%) Frame = +3 Query: 117 RFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKSSLS 296 + DV +Y PEEI K + + V +H + +E+ R F LP+G +K+ +S Sbjct: 11 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFTLPEGVEASNVKTRIS 70 Query: 297 RDGVLTVEA 323 G L +EA Sbjct: 71 NHGQLHIEA 79 >SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 48.8 bits (111), Expect = 3e-06 Identities = 24/80 (30%), Positives = 46/80 (57%) Frame = +3 Query: 84 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKG 263 + +GD K + DV+ + P+ I V+ + +LLV A HE + + +NR+F+LP+ Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 150 Query: 264 TNPEAIKSSLSRDGVLTVEA 323 + +++ + L ++G L EA Sbjct: 151 VDMDSLTTRLDKEGKLHFEA 170 Score = 45.2 bits (102), Expect = 3e-05 Identities = 22/69 (31%), Positives = 35/69 (50%) Frame = +3 Query: 117 RFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKSSLS 296 + DV +Y PEEI K + + V +H + +E+ R F LP+G +K+ +S Sbjct: 11 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFALPEGVEASNVKTRIS 70 Query: 297 RDGVLTVEA 323 G L +EA Sbjct: 71 NHGQLHIEA 79 >SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 48.8 bits (111), Expect = 3e-06 Identities = 24/80 (30%), Positives = 46/80 (57%) Frame = +3 Query: 84 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKG 263 + +GD K + DV+ + P+ I V+ + +LLV A HE + + +NR+F+LP+ Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 150 Query: 264 TNPEAIKSSLSRDGVLTVEA 323 + +++ + L ++G L EA Sbjct: 151 VDMDSLTTRLDKEGKLHFEA 170 Score = 45.2 bits (102), Expect = 3e-05 Identities = 22/69 (31%), Positives = 35/69 (50%) Frame = +3 Query: 117 RFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKSSLS 296 + DV +Y PEEI K + + V +H + +E+ R F LP+G +K+ +S Sbjct: 11 KLDVREYRPEEISFKVENGFVKVQGRHVNEGPFGFELKEFRRTFALPEGVEASNVKTRIS 70 Query: 297 RDGVLTVEA 323 G L +EA Sbjct: 71 NHGQLHIEA 79 >SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) Length = 210 Score = 48.8 bits (111), Expect = 3e-06 Identities = 25/78 (32%), Positives = 41/78 (52%) Frame = +3 Query: 90 EGDGKTLKLRFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGTN 269 EGD K DV Y PEEI +K ++ + KH+ + + E++R + LP G + Sbjct: 36 EGD-KVEIATLDVKNYRPEEISLKVEHGRIKIDGKHKSEGEHGYETSEFHRSYNLPDGVD 94 Query: 270 PEAIKSSLSRDGVLTVEA 323 + S ++ DG+L +EA Sbjct: 95 VSTVSSRITGDGLLHIEA 112 Score = 31.5 bits (68), Expect = 0.42 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +3 Query: 237 NREFLLPKGTNPEAIKSSLSRDGVLTVEA 323 NR F+LPK + +++ S L +DG L +EA Sbjct: 160 NRHFVLPKDVDMDSLVSRLGKDGKLYIEA 188 >SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) Length = 695 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/78 (29%), Positives = 41/78 (52%) Frame = +3 Query: 90 EGDGKTLKLRFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGTN 269 E + DV + PE I V+ + +LLV A HE + + +NR+F+LP+ + Sbjct: 93 ESKDDKFSMAMDVKGFPPEAIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFILPREVD 152 Query: 270 PEAIKSSLSRDGVLTVEA 323 +++ + L ++G L EA Sbjct: 153 MDSLTTRLDKEGKLHFEA 170 Score = 45.6 bits (103), Expect = 2e-05 Identities = 22/69 (31%), Positives = 35/69 (50%) Frame = +3 Query: 117 RFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGTNPEAIKSSLS 296 + DV +Y PEEI K + + V +H + +E+ R F LP+G +K+ +S Sbjct: 12 KLDVREYRPEEISFKVENGVVKVQGRHVNEGPFGFELKEFRRTFTLPEGVEASNVKTRIS 71 Query: 297 RDGVLTVEA 323 G L +EA Sbjct: 72 NHGQLHIEA 80 >SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) Length = 259 Score = 41.9 bits (94), Expect = 3e-04 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +3 Query: 96 DGKTLKLRFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGTN-P 272 D L DVS + PEE+ VK ++L V A+ E + R++NR F+LP+ Sbjct: 24 DDTKFTLALDVSDFKPEEVDVKVYGHELSVRARQECEEHGFFTARQFNRHFVLPQEVKIT 83 Query: 273 EAIKSSLSR 299 IK ++S+ Sbjct: 84 HQIKHAISK 92 >SB_6186| Best HMM Match : HSP20 (HMM E-Value=1.1e-06) Length = 237 Score = 36.7 bits (81), Expect = 0.011 Identities = 21/100 (21%), Positives = 46/100 (46%) Frame = +3 Query: 60 DSLNSPLIQDEGDGKTLKLRFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYN 239 ++ I + D +KL +V + +++ ++ L++ + +K D R++ Sbjct: 84 ETFTPTFIVTQNDKNGIKLEMNVRGFAAKDVSLQVDGQDLIIKGEKMDKDDGWCKMRQFC 143 Query: 240 REFLLPKGTNPEAIKSSLSRDGVLTVEAPLPQLAITDRNI 359 PK T+ ++IK++L +L +EA +L T I Sbjct: 144 WRRRFPKSTDMKSIKATLKYGDILEIEAQKERLIDTSGKI 183 >SB_3533| Best HMM Match : Pentapeptide (HMM E-Value=5.7) Length = 416 Score = 30.7 bits (66), Expect = 0.74 Identities = 19/81 (23%), Positives = 41/81 (50%) Frame = +3 Query: 24 SDSRQLAEPSHWDSLNSPLIQDEGDGKTLKLRFDVSQYTPEEIVVKTVDYKLLVHAKHEE 203 ++ RQLAE +H++ ++ L Q++G + ++F Y+ + T++++ V+ + Sbjct: 45 AEPRQLAE-AHFNHVSWQLNQEDGQLEIADVKFMDFSYSKTTLTDATIEHRFEVNRCNMR 103 Query: 204 KSDTKSVYREYNREFLLPKGT 266 S+Y+ Y KGT Sbjct: 104 NLLPNSIYKVYKSYQKRTKGT 124 >SB_19678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 30.3 bits (65), Expect = 0.97 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 183 VHAKHEEKSDTKSVYREYNREFLLPKGTNPE 275 V+A+ + K D S YR R LP+G NPE Sbjct: 734 VYAESDTKPDVISDYRRGQRRRTLPRGCNPE 764 >SB_16018| Best HMM Match : Antimicrobial18 (HMM E-Value=0.89) Length = 1494 Score = 29.9 bits (64), Expect = 1.3 Identities = 31/94 (32%), Positives = 45/94 (47%), Gaps = 5/94 (5%) Frame = -2 Query: 352 LSVMASCGSGASTVSTPSLDNEDLIASGFVP--FGSRNSLL---YSLYTDFVSDFSSCLA 188 LSV + S S T S D ++S +P F + +SLL SL +DF++ SS Sbjct: 654 LSVFPTSSSLPSDFLTSSSSPSDFLSSSSLPSDFLTSSSLLSDFLSLPSDFLTSSSSLSD 713 Query: 187 WTNNL*STVLTTISSGVYWLTSKRSFRVLPSPSS 86 + +L S LT+ S +LTS S + SS Sbjct: 714 FLTSLPSDFLTSSSLPSDFLTSSSSLSDFLTSSS 747 Score = 28.7 bits (61), Expect = 3.0 Identities = 30/91 (32%), Positives = 41/91 (45%), Gaps = 2/91 (2%) Frame = -2 Query: 352 LSVMASCGSGASTVSTPSLDNEDLI--ASGFVPFGSRNSLLYSLYTDFVSDFSSCLAWTN 179 LS + S S T S D + +S F + +S L T S S L ++ Sbjct: 384 LSDFLTSSSSLSDFLTSSSSLSDFLTSSSSLSDFLTSSSSLSDFLTSS-SSLSDFLTSSS 442 Query: 178 NL*STVLTTISSGVYWLTSKRSFRVLPSPSS 86 +L S LT+ SS +LTS S V P+PSS Sbjct: 443 SL-SDFLTSCSSLSDFLTSSSSLSVFPTPSS 472 >SB_51290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 326 Score = 29.1 bits (62), Expect = 2.2 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +1 Query: 244 NSCCQRVRTLRRSSLRCPGTVYSPWRLRCHSSPSPTGTSLSRST 375 NS C R R+ RS P T S RC S P G ++ + T Sbjct: 284 NSYCYRYRSAARSQ-NSPDTTASNLGFRCASDSPPPGVTIIKKT 326 >SB_33020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 696 Score = 29.1 bits (62), Expect = 2.2 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +1 Query: 214 QNLCTESTTGNSCCQRVRTLRRSSLRCPGTVYSPWRLRCHSSPSPTGTSLSRSTE 378 Q L T +T + C QR +T ++ R + P R+ HSSPSP S ++ + Sbjct: 625 QVLSTVQSTTDICTQRKKTRTQTRDR---KAWKPERMFVHSSPSPAPHSKTQEAQ 676 >SB_22269| Best HMM Match : Metallothionein (HMM E-Value=0.89) Length = 251 Score = 28.7 bits (61), Expect = 3.0 Identities = 23/63 (36%), Positives = 30/63 (47%) Frame = +1 Query: 172 TNYWSTPNTRRNLTQNLCTESTTGNSCCQRVRTLRRSSLRCPGTVYSPWRLRCHSSPSPT 351 T + S PNT R+ N T +T NS T R +SL SP H+SP+P Sbjct: 194 TRHNSLPNTTRH---NSLTNTTRHNSL---PNTTRHNSLPNITRHNSPSNTTRHNSPTPP 247 Query: 352 GTS 360 GT+ Sbjct: 248 GTT 250 >SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) Length = 2157 Score = 27.9 bits (59), Expect = 5.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 27 DSRQLAEPSHWDSLNSPLIQDEGDGKTLKLRFDVSQYTPEE 149 DS + E + WD+ + D+GD KT++ D S Y E Sbjct: 1566 DSHEGKEKNEWDNYDGD--NDDGDSKTIEANKDKSVYHHSE 1604 >SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 27.9 bits (59), Expect = 5.2 Identities = 24/90 (26%), Positives = 38/90 (42%) Frame = +1 Query: 121 STSASTLPRKSSLRL*ITNYWSTPNTRRNLTQNLCTESTTGNSCCQRVRTLRRSSLRCPG 300 S +++ PR S STP T T + + STT NS + T S+ R Sbjct: 80 SAPSTSTPRTGSTTTTSAPSTSTPRTGSTTTTSAPSTSTTSNSTTRAPST---STPRTGS 136 Query: 301 TVYSPWRLRCHSSPSPTGTSLSRSTELNST 390 T+ + +P+ TS+SR+ +T Sbjct: 137 TITLRTSTTSVMTTTPSTTSISRAGSTTTT 166 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 Query: 245 IPAAKGYEP*GDQVFVVQGRCTHRGGSAATARHHRQEHP 361 +PA P D+ + Q T+ GGS + H R+ P Sbjct: 774 MPAQTSSSPGNDRCGIPQNESTYHGGSTQSHAHKRESSP 812 >SB_48483| Best HMM Match : SH3_1 (HMM E-Value=7.1e-23) Length = 936 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +2 Query: 305 CTHRGGSAATARHHRQEHPYPEALS*IPHGSYSILLIIYFNLRII 439 C HR T R + +P + PH SY +L ++L I+ Sbjct: 509 CAHRSSLPLTRRFSYSQIVFPSHIVFTPHRSYLLLTDRLYHLHIV 553 >SB_29219| Best HMM Match : 7tm_1 (HMM E-Value=9.8e-06) Length = 863 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 277 RSSLRCPGTVYSPWRLRCHSSPSPTGTSLSRSTELNST 390 R +RC G SP SSP P +S S S+ +S+ Sbjct: 560 RGDIRCLGRFVSPPSSSSSSSPPPASSSSSSSSSSSSS 597 >SB_13470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1483 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 280 SSLRCPGTVYSPWRLRCHSSPSPTGTSLSRSTELNS 387 +SL+CPGT S R + SP G +S T + S Sbjct: 1440 TSLQCPGTTLSGHCHRSKNKGSPVGMVMSGQTSIIS 1475 >SB_19101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 190 PNTRRNLTQNLCTESTTGNSCCQRVRTLRR 279 PNTR++ T L TE + C R TL R Sbjct: 16 PNTRQHYTIELGTERSVAQGACNRQITLDR 45 >SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) Length = 1420 Score = 27.5 bits (58), Expect = 6.9 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 10/58 (17%) Frame = +1 Query: 205 NLTQNLCTE-STTGNSCCQ---------RVRTLRRSSLRCPGTVYSPWRLRCHSSPSP 348 N+ +NLC + + G +CC + TLR+ + RCP + + C S+ SP Sbjct: 65 NILKNLCPKIAQGGKTCCDLRQLEALDSNLNTLRQFTSRCPACWQNMLDMYCESTCSP 122 Score = 27.5 bits (58), Expect = 6.9 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 10/58 (17%) Frame = +1 Query: 205 NLTQNLCTE-STTGNSCCQ---------RVRTLRRSSLRCPGTVYSPWRLRCHSSPSP 348 N+ +NLC + + G +CC + TLR+ + RCP + + C S+ SP Sbjct: 285 NILKNLCPKIAQGGKTCCDLRQLEALDSNLNTLRQFTSRCPACWQNMLDMYCESTCSP 342 >SB_56512| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1219 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -1 Query: 98 VTFILNQ-R*VEAVPVTWLGQLSAITMLCGC 9 VT I+ Q R V +PVTW G +S L GC Sbjct: 910 VTRIVTQGRYVRVLPVTWHGHISMRMELFGC 940 >SB_44362| Best HMM Match : Transposase_24 (HMM E-Value=6.3) Length = 306 Score = 27.1 bits (57), Expect = 9.1 Identities = 25/124 (20%), Positives = 56/124 (45%), Gaps = 7/124 (5%) Frame = +3 Query: 21 HSDSRQLAEPSHWDSLNSPLIQDEGDGKTLKLRFDVSQYTPEEI-VVKTVDYKLLVHAKH 197 H D +++ P HWD+++S L + D + + + P + +D++L K Sbjct: 96 HPDKVEVSSPYHWDNIDSSL-ANWTDLFLAAVNEHIPKSKPRNVNDYPWIDHELRSLLKK 154 Query: 198 EEKSDTKSVYREYNR--EFLLPKGTNPEAIKS-SLSRDGVL---TVEAPLPQLAITDRNI 359 ++ TK++ NR + + E + + +R+ VL +++ +P++ RN+ Sbjct: 155 KDAQHTKNIANLLNRYIHSIFSSSASEEFVSAIPTNREPVLGLGSIQLTVPEVLDVLRNL 214 Query: 360 PIQK 371 K Sbjct: 215 DSHK 218 >SB_28946| Best HMM Match : Occludin_ELL (HMM E-Value=0.27) Length = 396 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = +3 Query: 93 GDGKTLKLRFDVSQYTPEEIVVKTVDYKLLVHAKHEEKSDTKSVYREYNREFLLPKGT 266 G+GKT ++ + QY P E + + YK ++EE K+ ++F+ KG+ Sbjct: 337 GEGKTAEMDYK-KQYRPIETYEQRLLYKQDFQVEYEEYLHLKNKIDNVTKKFMELKGS 393 >SB_6803| Best HMM Match : 7tm_1 (HMM E-Value=4.3) Length = 129 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 335 LWQRSLHGEYTVPGQRRLDRLRVRTL 258 LWQR GE++ +R +D ++R L Sbjct: 27 LWQRKTPGEHSKTNKRNMDNRKMRVL 52 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,271,058 Number of Sequences: 59808 Number of extensions: 395766 Number of successful extensions: 1154 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1154 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -