BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_F21 (388 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1223.13 |cbf12||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Ma... 26 2.4 SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||M... 25 3.1 SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces... 25 4.1 SPBC336.07 |sfc3||transcription factor TFIIIC complex subunit Sf... 24 9.6 >SPCC1223.13 |cbf12||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Manual Length = 963 Score = 25.8 bits (54), Expect = 2.4 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -1 Query: 313 PSVPQTGAYMKVQTQGSASSHVPSFT 236 PS+ Q Y +Q GS+++ +PSF+ Sbjct: 173 PSLNQMQDYQNLQQNGSSNTTIPSFS 198 >SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||Manual Length = 757 Score = 25.4 bits (53), Expect = 3.1 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = -1 Query: 76 NIPSIFILCYCLWHK 32 ++PSI+ILC+C H+ Sbjct: 34 SLPSIYILCHCSKHQ 48 >SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 967 Score = 25.0 bits (52), Expect = 4.1 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 221 QRFENRERGYV*GSRSLRLY 280 Q + +RGYV G R+LRLY Sbjct: 901 QHKDTYDRGYVRGLRTLRLY 920 >SPBC336.07 |sfc3||transcription factor TFIIIC complex subunit Sfc3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1339 Score = 23.8 bits (49), Expect = 9.6 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 173 DLPQPVPLVLREGQDAQRFENRERGYV*GSRS 268 D+P +PL L + Q+ + EN E+G + ++S Sbjct: 1048 DMPFTMPLSLNDKQNNEGDENCEKGQLFDAKS 1079 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,554,144 Number of Sequences: 5004 Number of extensions: 29893 Number of successful extensions: 71 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 128344734 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -