BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_F20 (539 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 23 2.6 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 23 2.6 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 8.1 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 22.6 bits (46), Expect = 2.6 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = +2 Query: 356 PSSLGYGNRGAGNVIPPHATLHFEVELINIGDSPPTTNVFKEID 487 P + Y R N+ P L F +EL + +SP F + D Sbjct: 111 PIATKYLRRYEDNIFLPEDCLLFTIELDRVLESPRGKYEFSKYD 154 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 22.6 bits (46), Expect = 2.6 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = +2 Query: 356 PSSLGYGNRGAGNVIPPHATLHFEVELINIGDSPPTTNVFKEID 487 P + Y R N+ P L F +EL + +SP F + D Sbjct: 126 PIATKYLRRYEDNIFLPEDCLLFTIELDRVLESPRGKYEFSKYD 169 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 359 SSLGYGNRGAGNVIPPHATLH 421 S+ G +RG + I P+AT H Sbjct: 1709 SAEGLSHRGMEDEICPYATFH 1729 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,243 Number of Sequences: 438 Number of extensions: 2867 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -