BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_F19 (550 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0431 - 15858381-15858529,15858864-15858935,15859045-158591... 28 5.6 04_03_0421 - 15725045-15725193,15725528-15725599,15725709-157257... 28 5.6 >04_03_0431 - 15858381-15858529,15858864-15858935,15859045-15859120, 15860651-15860734 Length = 126 Score = 27.9 bits (59), Expect = 5.6 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 415 GCIIRSNSHCLNNGFRRHWYKRAVVLLILL 326 G ++H +++G+R HW K VLL+ + Sbjct: 90 GATYTVDAHNISSGWRFHWQKHLAVLLVTM 119 >04_03_0421 - 15725045-15725193,15725528-15725599,15725709-15725784, 15728607-15728679,15728919-15728983,15729423-15729681, 15729761-15729931,15730014-15730846,15731097-15731390, 15731469-15731939 Length = 820 Score = 27.9 bits (59), Expect = 5.6 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -1 Query: 415 GCIIRSNSHCLNNGFRRHWYKRAVVLLILL 326 G ++H +++G+R HW K VLL+ + Sbjct: 784 GATYTVDAHNISSGWRFHWQKHLAVLLVTM 813 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,979,327 Number of Sequences: 37544 Number of extensions: 227346 Number of successful extensions: 374 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 374 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -