BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_F18 (661 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 29 0.034 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 23 2.2 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 5.1 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 6.8 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 9.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 29.1 bits (62), Expect = 0.034 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = -3 Query: 74 HLLPNSCSPGIHYS 33 HL+P +C+PG+HY+ Sbjct: 1228 HLVPQNCAPGLHYN 1241 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 233 YIFLQCVDSFMKFISKRKNTKF 168 ++FL DS++K K K KF Sbjct: 16 FLFLLICDSYLKIYHKEKYRKF 37 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -3 Query: 80 VPHLLPNSCSPGIHYSRAPPPR 15 + HL+ N SPG P PR Sbjct: 402 IVHLIANLPSPGSDQRSTPSPR 423 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 6.8 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +1 Query: 541 SAPSAIVPTVNTNDTPCITKTGQEGVCVKDYFCNNNEMTN 660 SA S NTN+ P T + + CN+ MT+ Sbjct: 1011 SATSNSSVNANTNNIPTNAGTTPGAILAFSWACNDAVMTS 1050 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 Query: 537 NGGWFLSSSGDGYRIDC 487 NGG S G GY DC Sbjct: 387 NGGVCRISDGGGYICDC 403 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,857 Number of Sequences: 336 Number of extensions: 3657 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -