BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_F17 (528 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 8.9 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.9 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 8.9 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 8.9 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 20.6 bits (41), Expect = 8.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 235 EIDFTPPFARVPMIASLEKI 294 E+ F P RV ++ S+EK+ Sbjct: 486 EVRFNPHTGRVEVLDSVEKL 505 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 20.6 bits (41), Expect = 8.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 418 QEVGL*SLAVGIPPRV 371 ++V L LAVG+PP V Sbjct: 1322 EDVTLPCLAVGLPPPV 1337 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 20.6 bits (41), Expect = 8.9 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +1 Query: 379 VECPPPRTTARLLDKLVGEFLEDKC 453 V+C T +L KL+ + ED C Sbjct: 647 VDCDDVGTFGAILKKLLPKVYEDYC 671 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 20.6 bits (41), Expect = 8.9 Identities = 13/61 (21%), Positives = 23/61 (37%) Frame = +1 Query: 199 KYRPDGPSGEEVEIDFTPPFARVPMIASLEKILNVKLPSPDTLDTAESNALLSQLCEKHE 378 +YRPD PS + P + ++ + K+ + L S L +Q H Sbjct: 107 EYRPDSPSSMHMANTAAPNGHQTQVVYASCKLQAAAVTQNGVLGPTGSPPLTTQSMNNHH 166 Query: 379 V 381 + Sbjct: 167 M 167 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,404 Number of Sequences: 336 Number of extensions: 2871 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12782794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -