BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_F12 (370 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1004 + 30035704-30035934,30036030-30036287,30036382-300364... 28 2.6 11_01_0595 + 4732330-4732723,4732839-4732903,4733023-4733143,473... 27 4.6 >04_04_1004 + 30035704-30035934,30036030-30036287,30036382-30036479, 30036574-30037137,30037232-30037484,30037576-30037758, 30037839-30038465 Length = 737 Score = 27.9 bits (59), Expect = 2.6 Identities = 11/46 (23%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +2 Query: 182 HVTYASKNVFFGYILFIRTSLWVDQYKYIRNSESDS--FFFGFILY 313 + + S F Y++F R W +Y Y+ ++ D+ G ++Y Sbjct: 650 YTAWCSVGAVFNYLVFRRRKAWWQRYNYVLSAAMDAGVAIMGVLIY 695 >11_01_0595 + 4732330-4732723,4732839-4732903,4733023-4733143, 4733596-4733687,4733850-4733915,4734106-4734125, 4734147-4734239,4734358-4734445,4734570-4734635, 4734728-4734843,4735410-4735500,4736133-4736234, 4736342-4736425,4736551-4736643,4736728-4736823, 4736914-4736999,4737528-4737606,4737675-4737788, 4737890-4737985,4738060-4738123,4738221-4738510, 4738901-4738956,4739060-4739177,4739287-4739367, 4739683-4739762,4740001-4740055,4740142-4740211, 4740279-4740468,4740567-4740690,4741055-4741129, 4741217-4741390 Length = 1112 Score = 27.1 bits (57), Expect = 4.6 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +2 Query: 173 YKCHVTYASKNVFFGYILF--IRTSLWVDQYKYIRNSES 283 Y+C +TY + + F+G I F I +L + Y+R++ S Sbjct: 236 YRCDITYTNNSYFYGIIWFSKITHNLQELGFDYLRDNLS 274 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,337,616 Number of Sequences: 37544 Number of extensions: 130262 Number of successful extensions: 237 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 237 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 576724416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -