BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_F12 (370 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68220-10|CAA92491.2| 1843|Caenorhabditis elegans Hypothetical p... 27 3.2 Z92782-9|CAE17814.1| 329|Caenorhabditis elegans Hypothetical pr... 27 4.2 Z82055-6|CAB04851.1| 365|Caenorhabditis elegans Hypothetical pr... 27 4.2 Z70038-6|CAA93882.3| 1323|Caenorhabditis elegans Hypothetical pr... 26 7.3 X57767-1|CAA40919.1| 1323|Caenorhabditis elegans tyrosine kinase... 26 7.3 D63426-1|BAA09729.1| 1374|Caenorhabditis elegans receptor tyrosi... 26 7.3 AL032632-9|CAA21588.2| 1464|Caenorhabditis elegans Hypothetical ... 26 7.3 >Z68220-10|CAA92491.2| 1843|Caenorhabditis elegans Hypothetical protein T20D3.11 protein. Length = 1843 Score = 27.5 bits (58), Expect = 3.2 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 215 GYILFIRTSLWVDQYKYIRNSESDSF 292 GYI+F T LW Y+ NS SF Sbjct: 593 GYIIFTLTMLWSGNNLYVMNSTLRSF 618 >Z92782-9|CAE17814.1| 329|Caenorhabditis elegans Hypothetical protein F14F8.12 protein. Length = 329 Score = 27.1 bits (57), Expect = 4.2 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +2 Query: 236 TSLWVDQYKYIRNSESDSFFFGFILY 313 TS W+D+ KY+ + + F F+ + Sbjct: 141 TSFWLDELKYLNDDIFECFIISFVFF 166 >Z82055-6|CAB04851.1| 365|Caenorhabditis elegans Hypothetical protein T26H2.6 protein. Length = 365 Score = 27.1 bits (57), Expect = 4.2 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +2 Query: 206 VFFGYILFIRTSLWVDQYKYIRNSESDSFFFGF-ILY 313 V GY+L I ++ +V +Y + N ++ +FFG+ +LY Sbjct: 103 VSVGYVLLILSAQFVFRYFAMHNKKNLKYFFGWRLLY 139 >Z70038-6|CAA93882.3| 1323|Caenorhabditis elegans Hypothetical protein ZK1067.1 protein. Length = 1323 Score = 26.2 bits (55), Expect = 7.3 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +2 Query: 47 CVYTMKYSNKSLYAYARYNINC*CIRLRLKLLYIHIY 157 C Y +KY N +++ +N C+ L YI Y Sbjct: 647 CKYAVKYENDTIFCLQSSGMNNVCVENDLPNYYISTY 683 >X57767-1|CAA40919.1| 1323|Caenorhabditis elegans tyrosine kinase protein. Length = 1323 Score = 26.2 bits (55), Expect = 7.3 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +2 Query: 47 CVYTMKYSNKSLYAYARYNINC*CIRLRLKLLYIHIY 157 C Y +KY N +++ +N C+ L YI Y Sbjct: 647 CKYAVKYENDTIFCLQSSGMNNVCVENDLPNYYISTY 683 >D63426-1|BAA09729.1| 1374|Caenorhabditis elegans receptor tyrosine kinase protein. Length = 1374 Score = 26.2 bits (55), Expect = 7.3 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +2 Query: 47 CVYTMKYSNKSLYAYARYNINC*CIRLRLKLLYIHIY 157 C Y +KY N +++ +N C+ L YI Y Sbjct: 698 CKYAVKYENDTIFCLQSSGMNNVCVENDLPNYYISTY 734 >AL032632-9|CAA21588.2| 1464|Caenorhabditis elegans Hypothetical protein Y11D7A.14 protein. Length = 1464 Score = 26.2 bits (55), Expect = 7.3 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = +2 Query: 182 HVTYASKNVFFG--YILFIRTSLWVDQYKYIRNSES 283 H+ Y + +F + F++ S V++YKY+RN +S Sbjct: 269 HIFYQMLSNYFDNPHKSFLKLSKKVNEYKYLRNDDS 304 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,902,535 Number of Sequences: 27780 Number of extensions: 139879 Number of successful extensions: 300 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 300 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 524900642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -