BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_F11 (647 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual 28 1.3 SPAC1834.09 |mug51||conserved fungal protein|Schizosaccharomyces... 26 4.1 SPAC2C4.07c |||ribonuclease II |Schizosaccharomyces pombe|chr 1|... 26 5.4 SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 26 5.4 SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||... 26 5.4 SPCC126.13c |||histone deacetylase complex subunit, SAP128 famil... 25 7.1 SPBC16D10.10 |||tRNA specific adenosine deaminase subunit Tad2 |... 25 7.1 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 25 7.1 SPBC1773.11c |mug89||CDC50 domain protein|Schizosaccharomyces po... 25 9.4 SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces pomb... 25 9.4 SPCC1322.03 |||TRP-like ion channel|Schizosaccharomyces pombe|ch... 25 9.4 SPAC30C2.06c |dml1||mitochondrial genome maintenance protein |Sc... 25 9.4 >SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 1202 Score = 27.9 bits (59), Expect = 1.3 Identities = 19/60 (31%), Positives = 32/60 (53%) Frame = +3 Query: 456 NDKRLDMLEIDSFVYKLDTGKNNIVRSSLEMHGVIEQRPWTKNILEKGFDTTGTGFKSIE 635 N K L+ + + SFV K+N +++S E+ +IE+ + KN++ F G KS E Sbjct: 754 NYKSLESIGLTSFV------KDNKLKASKELQKLIEENVFPKNLILFIFRKCVIGIKSFE 807 >SPAC1834.09 |mug51||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +3 Query: 138 VLFKNMLPSYTREELDF 188 +L +N LPSYT EEL F Sbjct: 176 LLIENPLPSYTSEELKF 192 >SPAC2C4.07c |||ribonuclease II |Schizosaccharomyces pombe|chr 1|||Manual Length = 927 Score = 25.8 bits (54), Expect = 5.4 Identities = 9/30 (30%), Positives = 21/30 (70%) Frame = -2 Query: 292 ISAWSR*SAFVISMSYSSIKVTIFSDTTRS 203 +S+ R +F+++ SS+K+T+F D+ ++ Sbjct: 868 LSSDDRIKSFIVAPDDSSVKITLFDDSQKT 897 >SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 534 Score = 25.8 bits (54), Expect = 5.4 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -2 Query: 256 SMSYSSIKVTIFSDTTRSTLTPGKSSSSR 170 S S+SS V+ S T+ STLT SSSSR Sbjct: 365 SSSFSST-VSSSSSTSSSTLTSSSSSSSR 392 >SPBPJ4664.02 |||glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 3971 Score = 25.8 bits (54), Expect = 5.4 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 394 TQSFVYLLVPNTIAWAAS*ASMTNALTCSKSIASSINSTL 513 TQS Y +T+ W+ S T+ S+ +++ NST+ Sbjct: 3866 TQSVYYNATSSTVPWSNSTFRNTSNTMTSRFVSNDFNSTI 3905 >SPCC126.13c |||histone deacetylase complex subunit, SAP128 family |Schizosaccharomyces pombe|chr 3|||Manual Length = 145 Score = 25.4 bits (53), Expect = 7.1 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = +3 Query: 39 DKYTYVPTALDMYTTCLRDPVFW---KIMKR 122 DKY P A D+ T CL +P + K++KR Sbjct: 93 DKYKDRPIARDLGTVCLHNPKLFQGNKLLKR 123 >SPBC16D10.10 |||tRNA specific adenosine deaminase subunit Tad2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 367 Score = 25.4 bits (53), Expect = 7.1 Identities = 12/52 (23%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = -1 Query: 587 YVFSPRSLFDNAVHLERAADDVVLTSVEFIDEAIDF--EHVKAFVIDAHEAA 438 +V + +D+++H R D++L E ID A+ F +H++ + + ++ + Sbjct: 152 FVTLSKPAYDSSIHPTRENADIILPQKENIDTALLFVSQHLQDILAEMNKTS 203 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 25.4 bits (53), Expect = 7.1 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +3 Query: 219 EKMVTFMDEYDMDITNALYLDQAEMQKKKSDMVYVARMRRLNHQPFKV 362 EK+ T + ITN+ Y D +M+ + SD++ +H+ +V Sbjct: 194 EKIETSTSVENAYITNSQYNDTLDMEDQTSDLITTFEHENEDHEVHEV 241 >SPBC1773.11c |mug89||CDC50 domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 396 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 331 CGVLITSLSRCLSMLCQIRLLTQSFVYLLVPNTIAWAA 444 CG++ SL +RLL + VY IAWA+ Sbjct: 203 CGLIANSLFN--DTFSSLRLLDDNSVYTFSTKNIAWAS 238 >SPCC290.03c |nup186||nucleoporin Nup186|Schizosaccharomyces pombe|chr 3|||Manual Length = 1647 Score = 25.0 bits (52), Expect = 9.4 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -1 Query: 452 AHEAAHAIVFGTNKYTNDCVNSLI*HNIDRHLERL 348 A E +A G NKY N+ V SLI N H L Sbjct: 1147 ATEIHYAASVGQNKYLNEYVASLIRTNEKTHSTEL 1181 >SPCC1322.03 |||TRP-like ion channel|Schizosaccharomyces pombe|chr 3|||Manual Length = 862 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 641 PTLDALETCSSCVETFFQYVFSPRSLFDNAVHLER 537 P+LD ETCS+ V FSP ++ N + R Sbjct: 27 PSLDYFETCSNFVPRAGIPTFSPYAVIKNFDEVNR 61 >SPAC30C2.06c |dml1||mitochondrial genome maintenance protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 465 Score = 25.0 bits (52), Expect = 9.4 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -1 Query: 275 VKCIRDIHVIFIHKGDHLFRYNAFNFDTREIKFLASITRQHVFEKHERVHD 123 VK D + +F+ ++LF N ++ + F + R H F+K V D Sbjct: 139 VKYWSDFNRLFLDT-EYLFPVNCSELNSSDFSFQLGVERFHDFDKQFNVWD 188 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,614,774 Number of Sequences: 5004 Number of extensions: 52300 Number of successful extensions: 214 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 214 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -