BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_F10 (177 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 24 0.15 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 0.45 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 1.4 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 1.4 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 1.4 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 1.8 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 20 2.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 20 2.4 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 20 3.1 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 20 3.1 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 20 3.1 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 20 3.1 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 19 5.5 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 19 5.5 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 19 7.3 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 19 7.3 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 18 9.6 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 18 9.6 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 24.2 bits (50), Expect = 0.15 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +1 Query: 67 INYWIQNGAPTHKLVLGIST--TGRTWKLDSDSEISR 171 +++WI A + ++ LGI+T T T LDS +++ + Sbjct: 264 VSFWIHREATSDRVGLGITTVLTLSTISLDSRTDLPK 300 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.6 bits (46), Expect = 0.45 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 67 INYWIQNGAPTHKLVLGIST 126 +++WI + A + ++ LGI+T Sbjct: 261 VSFWINHEATSARVALGITT 280 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 1.4 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +1 Query: 67 INYWIQNGAPTHKLVLGIST 126 +++W+ A ++ LG++T Sbjct: 240 VSFWLNRNATPARVALGVTT 259 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 1.4 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +1 Query: 67 INYWIQNGAPTHKLVLGIST 126 +++W+ A ++ LG++T Sbjct: 240 VSFWLNRNATPARVALGVTT 259 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.0 bits (42), Expect = 1.4 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +1 Query: 67 INYWIQNGAPTHKLVLGIST 126 +++W+ A ++ LG++T Sbjct: 179 VSFWLNRNATPARVALGVTT 198 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 20.6 bits (41), Expect = 1.8 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = +1 Query: 67 INYWIQNGAPTHKLVLGIST 126 +++W+ A ++ LGI+T Sbjct: 233 VSFWLNREATADRVSLGITT 252 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 20.2 bits (40), Expect = 2.4 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = +1 Query: 67 INYWIQNGAPTHKLVLGIST 126 +++W+ A ++VLG +T Sbjct: 251 VSFWLHMDASPPRIVLGTNT 270 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 20.2 bits (40), Expect = 2.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 Query: 103 CG*AHHFESS 74 C HHFESS Sbjct: 73 CSDVHHFESS 82 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 19.8 bits (39), Expect = 3.1 Identities = 7/17 (41%), Positives = 10/17 (58%), Gaps = 1/17 (5%) Frame = +3 Query: 72 LLDSKWCAYPQTCP-WY 119 L+D+ W YP P W+ Sbjct: 36 LIDANWYQYPPLNPMWH 52 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 19.8 bits (39), Expect = 3.1 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +1 Query: 67 INYWIQNGAPTHKLVLGIST 126 +++W+ A ++ LG++T Sbjct: 261 VSFWLDQSAVPARVSLGVTT 280 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 19.8 bits (39), Expect = 3.1 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +1 Query: 67 INYWIQNGAPTHKLVLGIST 126 +++W+ A ++ LG++T Sbjct: 261 VSFWLDQSAVPARVSLGVTT 280 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 19.8 bits (39), Expect = 3.1 Identities = 7/17 (41%), Positives = 10/17 (58%), Gaps = 1/17 (5%) Frame = +3 Query: 72 LLDSKWCAYPQTCP-WY 119 L+D+ W YP P W+ Sbjct: 2 LIDANWYQYPPLNPMWH 18 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 19.0 bits (37), Expect = 5.5 Identities = 5/20 (25%), Positives = 14/20 (70%) Frame = +1 Query: 67 INYWIQNGAPTHKLVLGIST 126 +++WI+ A ++ LG+++ Sbjct: 264 VSFWIKPEAAPARVTLGVTS 283 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 19.0 bits (37), Expect = 5.5 Identities = 5/11 (45%), Positives = 11/11 (100%) Frame = -1 Query: 90 TILNPVIYSSV 58 ++LNP+IY+++ Sbjct: 420 SLLNPIIYATL 430 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 18.6 bits (36), Expect = 7.3 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 74 TGFKMVRLPTNLSL 115 TGF+ R PT++ L Sbjct: 170 TGFEHKRQPTSIDL 183 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 18.6 bits (36), Expect = 7.3 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 74 TGFKMVRLPTNLSL 115 TGF+ R PT++ L Sbjct: 170 TGFEHKRQPTSIDL 183 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 18.2 bits (35), Expect = 9.6 Identities = 4/10 (40%), Positives = 6/10 (60%) Frame = +3 Query: 111 PWYQHHWTYV 140 PW+ +W V Sbjct: 279 PWFSEYWEEV 288 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 18.2 bits (35), Expect = 9.6 Identities = 4/10 (40%), Positives = 6/10 (60%) Frame = +3 Query: 111 PWYQHHWTYV 140 PW+ +W V Sbjct: 369 PWFSEYWEEV 378 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.311 0.127 0.386 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,289 Number of Sequences: 438 Number of extensions: 884 Number of successful extensions: 18 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 38 effective length of database: 129,699 effective search space used: 2593980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (18.7 bits)
- SilkBase 1999-2023 -