BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_F07 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.83 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 29 3.4 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 29 3.4 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 31.1 bits (67), Expect = 0.83 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 354 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFET 446 L+ CS+Q L +T T P+R++F++PH T Sbjct: 1421 LSTCSLQSLTDNT-TSERPIRISFSEPHLHT 1450 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 3/65 (4%) Frame = +2 Query: 68 TGYYPLMT-SYYFPF--AQRPDNYNLHSVKNYEAIRFLDIFEKTFVQSLQKGKFESYGKK 238 T Y P T S Y Q+P+N++LH +A+ T L GKF+S G+ Sbjct: 4715 TSYQPAATDSLYISSQSTQKPNNHHLHRTCKADALEV----NVTLRGGLHAGKFKSVGRT 4770 Query: 239 IDFHD 253 D H+ Sbjct: 4771 RDVHE 4775 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 260 PFHRGNQFSCHTIRICLSVGTVRKSFQKCPRTVLL-RSSLRCVDC 129 P H NQ C IC+ G KS KCP L S RC C Sbjct: 245 PCHEANQGGCEGRAICVYTGP-GKSICKCPPGYKLDESQARCTLC 288 >SB_29525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/61 (27%), Positives = 27/61 (44%) Frame = +2 Query: 413 ALDFYQTALRDPAFYQLYXRIVGYINAFKHYLKPYPQEKLHFVGV*INDVVVEKLVTFFD 592 AL + ALR P ++Y + ++ FK LK YP H + + L+ + D Sbjct: 180 ALRYVLDALRKPYGSKMYMFGIAALDRFKTRLKDYPHYCQHLASIPHFKEFPQSLIEYID 239 Query: 593 Y 595 Y Sbjct: 240 Y 240 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 29.1 bits (62), Expect = 3.4 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 6/91 (6%) Frame = +3 Query: 333 NDLMKLSLAMCSVQHLN--HSTSTPSCPVRLTFTKP---HFETLHS-ISYXTGLWVTLTH 494 ++L +L ++ HLN HST T S LT T H +S I++ T +TLTH Sbjct: 25 SNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTH 84 Query: 495 SSIT*SLILKRNFISSAXKSMMLSLRN*SHS 587 ++T S + S L+ +HS Sbjct: 85 LTLTYSTLTHSTLTHSTLTHSTLTHSTLTHS 115 Score = 28.7 bits (61), Expect = 4.4 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 2/84 (2%) Frame = +3 Query: 339 LMKLSLAMCSVQHLN--HSTSTPSCPVRLTFTKPHFETLHSISYXTGLWVTLTHSSIT*S 512 L L+L ++ HL +ST T S LT T H +++Y T TLTHS++T S Sbjct: 52 LTHLTLTYSTLTHLTITYSTITHSTLTHLTLT--HL----TLTYSTLTHSTLTHSTLTHS 105 Query: 513 LILKRNFISSAXKSMMLSLRN*SH 584 + S L+ N +H Sbjct: 106 TLTHSTLTHSTITHSTLTHSNLTH 129 Score = 28.3 bits (60), Expect = 5.9 Identities = 25/83 (30%), Positives = 37/83 (44%), Gaps = 1/83 (1%) Frame = +3 Query: 375 HLNHSTSTPSCPVRLTFTKPHFETLHSISYXTGLWVTLTHSSIT*SLILKRNFISSAXKS 554 +L HST T S L T T ++++ T + TLTH +IT S I Sbjct: 26 NLTHSTLTHSNLTHLNLTHSTL-TYSTLTHLTLTYSTLTHLTITYSTITHSTLTHLTLTH 84 Query: 555 MMLSLRN*SHS-LTIAXLMPLTV 620 + L+ +HS LT + L T+ Sbjct: 85 LTLTYSTLTHSTLTHSTLTHSTL 107 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = +2 Query: 203 LQKGKFE-----SYGKKIDFHDEKAINFVGNYWQENADL--YEEEVTKDYQ 334 L+KGKF+ S K ID E+ F+G+ W ++ DL +++E K+ Q Sbjct: 1093 LEKGKFQVKQWCSNSKTIDKSCERYCTFLGHKWDKDRDLLTFKKEKIKETQ 1143 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,418,485 Number of Sequences: 59808 Number of extensions: 394152 Number of successful extensions: 1083 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1081 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -