BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_F02 (550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) 218 2e-57 SB_53143| Best HMM Match : PKD (HMM E-Value=2.7e-18) 28 4.4 SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) 28 4.4 SB_11552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_33464| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0019) 27 7.6 >SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 218 bits (533), Expect = 2e-57 Identities = 101/160 (63%), Positives = 124/160 (77%) Frame = +3 Query: 24 LKEYEVIGRKLPSESEPKPPLYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGEIVSIKE 203 LKE++VIGR +P++ PPLYKMRIF+PD +VA+S+FWYF+ QLK+ KK+ GEIVS ++ Sbjct: 207 LKEFQVIGRLMPNKKLTVPPLYKMRIFAPDDVVARSKFWYFISQLKRMKKSQGEIVSCQQ 266 Query: 204 IPEKSPVKIKNFGIWLRYESRSGVHNMYREYRDLSVGGAVTQCYRDMGARHRARAHSIQI 383 I EK P++IKNFGIWLRY+SRSG HNMYREYRDL+V GAVT CYRDM ARHRAR +SIQI Sbjct: 267 IYEKKPLQIKNFGIWLRYDSRSGTHNMYREYRDLTVSGAVTACYRDMAARHRARGYSIQI 326 Query: 384 IKVEVIKAAACRRPQVKQFHTSKIGFPLPKRVHQYKRLNT 503 +KVEVI A+ RRP VKQ H + P Q L+T Sbjct: 327 MKVEVIPASKARRPHVKQMHVYGV-LPYFANFRQLAELST 365 >SB_53143| Best HMM Match : PKD (HMM E-Value=2.7e-18) Length = 2111 Score = 28.3 bits (60), Expect = 4.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 218 TLFWNFLDGYNFTSSL 171 T+FW+FLDG N T L Sbjct: 603 TMFWDFLDGNNLTQEL 618 >SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) Length = 348 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 464 ATKTRSPIQASQYLCIQEAEHVLYVI 541 A KTR P + + C Q EHV +V+ Sbjct: 227 ANKTRHPFLVNLFACFQTQEHVCFVM 252 >SB_11552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 750 Score = 27.5 bits (58), Expect = 7.6 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 33 YEVIGRKLPSESEPKPPLYKM 95 Y+V+ + PS + PK P+YKM Sbjct: 498 YDVMTERQPSMTTPKEPIYKM 518 >SB_33464| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0019) Length = 413 Score = 27.5 bits (58), Expect = 7.6 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = -1 Query: 247 QIPKFLILTGLFSGISLMDTISPVVFLNFFNCLKKYQKRDFATIGSGEKILILYRG 80 Q PK+ I +F+ I ++ + + F CL +Y+ + +A S L++ RG Sbjct: 290 QTPKYFIFNVIFAIIFVITATFLTILVTIFLCL-RYKPKSYAVDSSKGSPLLVPRG 344 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,680,701 Number of Sequences: 59808 Number of extensions: 335672 Number of successful extensions: 1192 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1192 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -