BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_F02 (550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 27 0.41 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 26 0.94 AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homoc... 25 1.6 AY280613-1|AAQ21366.1| 257|Anopheles gambiae carbonic anhydrase... 23 5.0 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 23 5.0 AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-tran... 23 8.8 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 27.1 bits (57), Expect = 0.41 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +1 Query: 433 SNSTPARSVSRYQNAFTNT 489 SNSTP+RSV+R +FT++ Sbjct: 1318 SNSTPSRSVARIVTSFTDS 1336 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 25.8 bits (54), Expect = 0.94 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 171 F*TSSTASRNTRNEILPQ*DQERKSSFCIEEALAR 67 F TSS+A T E+ + +RK+ C+ EALA+ Sbjct: 317 FETSSSAMTYTLYELALNQEAQRKARECVLEALAK 351 >AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homocysteine hydrolase protein. Length = 432 Score = 25.0 bits (52), Expect = 1.6 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 249 LRYESRSGVHNMYREYRDLSVG 314 L E+ +GVHN+Y+ +R+ +G Sbjct: 153 LSEETTTGVHNLYKMFREGRLG 174 >AY280613-1|AAQ21366.1| 257|Anopheles gambiae carbonic anhydrase alternate isoform protein. Length = 257 Score = 23.4 bits (48), Expect = 5.0 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 170 FELLQLPQEIPETRFCHN 117 F +Q+PQ++PE F N Sbjct: 231 FRSVQVPQQVPEVVFVRN 248 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 23.4 bits (48), Expect = 5.0 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +3 Query: 72 PKPPLYKMRIFSPDPIVAKSRFWY 143 P+P Y+ FSPD + + + Y Sbjct: 414 PEPEQYRPERFSPDEVARRDPYCY 437 >AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-transferase u2 protein. Length = 222 Score = 22.6 bits (46), Expect = 8.8 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -3 Query: 455 DLAGVELLNLWSTTCRCLDYFHFD 384 DL LN W +CR L F D Sbjct: 176 DLTNYPRLNAWYESCRVLKGFEDD 199 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 571,669 Number of Sequences: 2352 Number of extensions: 11953 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -