BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_F01 (573 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g53970.1 68416.m05963 proteasome inhibitor-related similar to... 32 0.24 At3g56600.1 68416.m06294 phosphatidylinositol 3- and 4-kinase fa... 31 0.55 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 30 1.3 At3g57630.2 68416.m06421 exostosin family protein contains Pfam ... 30 1.3 At3g57630.1 68416.m06420 exostosin family protein contains Pfam ... 30 1.3 At5g01950.1 68418.m00114 leucine-rich repeat transmembrane prote... 29 2.9 At3g26720.1 68416.m03341 glycosyl hydrolase family 38 protein si... 29 2.9 At5g13000.1 68418.m01490 glycosyl transferase family 48 protein ... 28 3.8 At1g64140.1 68414.m07266 expressed protein similar to putative d... 28 3.8 At1g15190.1 68414.m01816 hypothetical protein 28 3.8 At5g09670.2 68418.m01119 loricrin-related contains weak similari... 27 6.7 At5g09670.1 68418.m01118 loricrin-related contains weak similari... 27 6.7 At3g15820.1 68416.m02002 phosphatidic acid phosphatase-related /... 27 6.7 At2g32660.1 68415.m03992 disease resistance family protein / LRR... 27 6.7 At1g11340.1 68414.m01302 S-locus lectin protein kinase family pr... 27 6.7 At5g64550.1 68418.m08112 loricrin-related contains weak similari... 27 8.9 At5g60930.1 68418.m07643 chromosome-associated kinesin, putative... 27 8.9 >At3g53970.1 68416.m05963 proteasome inhibitor-related similar to proteasome inhibitor PI31 subunit (hPI31) SP:Q92530 from [Homo sapiens] Length = 302 Score = 32.3 bits (70), Expect = 0.24 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +2 Query: 56 PKTSSTPSALTYDDYGAADVGGASPRGHLRVGAPRERHGGEPGRETIPGG 205 P P +D YG V G P G PR GG P E PGG Sbjct: 250 PHPGMPPPGARFDPYGPPGVPGFEP-GRFTRQPPRGPGGGHPDLEHFPGG 298 >At3g56600.1 68416.m06294 phosphatidylinositol 3- and 4-kinase family protein low similarity to 55 kDa type II phosphatidylinositol 4-kinase [Rattus norvegicus] GI:13660755; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 533 Score = 31.1 bits (67), Expect = 0.55 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = -3 Query: 472 SEWSRQRQRCRYTSQSDDQVSLKFVHTLRLESVSYGHSLMQLQIASPCSLIS 317 S++SR QRCR S ++ + +T + + HSL +++PC IS Sbjct: 13 SQFSRSSQRCRLQSLTNLDFNFLGFNTKQTNLSASSHSLNNRSVSTPCFSIS 64 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 29.9 bits (64), Expect = 1.3 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +2 Query: 101 GAADVGGASPRGHLRVGAPRERHGGEPGRETIPGG*E-SSCLRDPE*VTRCS 253 G +GG P G G P GG PG +PGG + S L DPE +T S Sbjct: 349 GMPGMGGGMPAGMGGGGMPGAG-GGMPGGGGMPGGMDFSKILNDPELMTAFS 399 >At3g57630.2 68416.m06421 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 791 Score = 29.9 bits (64), Expect = 1.3 Identities = 23/101 (22%), Positives = 39/101 (38%), Gaps = 1/101 (0%) Frame = +3 Query: 237 ESRDAPDNEINLDDPC-MKVHCSAGRVCEINEHGEAICNCIKECPYETDSRRKVCTNFNE 413 + DA ++ + + C K C GR CEI C C+ +C R C Sbjct: 240 DPEDAYAMKVKIKEECDCKYDCLWGRFCEIPVQ----CTCVNQCSGHGKCRGGFCQCDKG 295 Query: 414 TWSSDCEVYRQRCLCLDHSELCRGAQYHHVQIEYYGNLQGN 536 + +DC + + + R A H+++ N+ GN Sbjct: 296 WFGTDCSIPSTLSTVGEWPQWLRPA---HLEVPSEKNVPGN 333 >At3g57630.1 68416.m06420 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 793 Score = 29.9 bits (64), Expect = 1.3 Identities = 23/101 (22%), Positives = 39/101 (38%), Gaps = 1/101 (0%) Frame = +3 Query: 237 ESRDAPDNEINLDDPC-MKVHCSAGRVCEINEHGEAICNCIKECPYETDSRRKVCTNFNE 413 + DA ++ + + C K C GR CEI C C+ +C R C Sbjct: 242 DPEDAYAMKVKIKEECDCKYDCLWGRFCEIPVQ----CTCVNQCSGHGKCRGGFCQCDKG 297 Query: 414 TWSSDCEVYRQRCLCLDHSELCRGAQYHHVQIEYYGNLQGN 536 + +DC + + + R A H+++ N+ GN Sbjct: 298 WFGTDCSIPSTLSTVGEWPQWLRPA---HLEVPSEKNVPGN 335 >At5g01950.1 68418.m00114 leucine-rich repeat transmembrane protein kinase, putative receptor protein kinases Length = 1032 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -3 Query: 277 SSRLISLSGASRDSFRISETRALSASWNRLSSRLSAMPFSR 155 S R SL GA D +I + L SWN L+ + + FS+ Sbjct: 334 SLRNCSLKGALPDFSKIRHLKYLDLSWNELTGPIPSSNFSK 374 >At3g26720.1 68416.m03341 glycosyl hydrolase family 38 protein similar to lysosomal alpha-mannosidase GI:3522867 from [Homo sapiens] Length = 1019 Score = 28.7 bits (61), Expect = 2.9 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 156 LENGMAESLDERRFQEAERARVSEILNESRDAPD 257 LENG E + RR Q + V EILNE+ P+ Sbjct: 794 LENGQIELMLHRRMQHDDIRGVGEILNETVCLPE 827 >At5g13000.1 68418.m01490 glycosyl transferase family 48 protein contains Pfam profile: PF02364 1,3-beta-glucan synthase Length = 1889 Score = 28.3 bits (60), Expect = 3.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 492 YHHVQIEYYGNLQGNAGVQRERNVR 566 YHH+ E YG L GN NV+ Sbjct: 362 YHHMAFELYGMLAGNVSPMTGENVK 386 >At1g64140.1 68414.m07266 expressed protein similar to putative disease resistance protein GB:CAB40943 GI:4586107 from [Arabidopsis thaliana]; weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 646 Score = 28.3 bits (60), Expect = 3.8 Identities = 19/62 (30%), Positives = 24/62 (38%), Gaps = 6/62 (9%) Frame = -1 Query: 321 SHRHGRRCSALSCTD--RQD*FHCQEH----RVTHSGSRRHELSQPPGIVSRPGSPPCRS 160 SH GRRC + CT + C+ H R THSG + P G C Sbjct: 377 SHGGGRRCQSNGCTKGAQGSTMFCKAHGGGKRCTHSGCTKGAEGSTPFCKGHGGGKRCAF 436 Query: 159 RG 154 +G Sbjct: 437 QG 438 >At1g15190.1 68414.m01816 hypothetical protein Length = 248 Score = 28.3 bits (60), Expect = 3.8 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = -3 Query: 286 MHGSSRLISLSGASRDSFRISETRALSASWNRLSSRLSAMPFSRCSDSEMSPRGSPA 116 +HG + L+ L+ S + + ++ AL+ S L SR S P + ++SP SP+ Sbjct: 159 VHGLADLLPLTAPSSPNRLVEDSTALAKSPWFLGSRFSPAPEPYFAFMDLSPAESPS 215 >At5g09670.2 68418.m01119 loricrin-related contains weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 546 Score = 27.5 bits (58), Expect = 6.7 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = -1 Query: 321 SHRHGRRCSALSCTDRQD*FHCQEHRVTHSGSRRHELSQPPGIVSRPGSPPCRSRGAPTR 142 +H G+RC L CT + + ++H G RR E + +R S C G + Sbjct: 199 THGGGKRCEHLGCTKSAE--GKTDFCISHGGGRRCEFLEGCDKAARGRSGLCIKHGG-GK 255 Query: 141 RC 136 RC Sbjct: 256 RC 257 >At5g09670.1 68418.m01118 loricrin-related contains weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 546 Score = 27.5 bits (58), Expect = 6.7 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = -1 Query: 321 SHRHGRRCSALSCTDRQD*FHCQEHRVTHSGSRRHELSQPPGIVSRPGSPPCRSRGAPTR 142 +H G+RC L CT + + ++H G RR E + +R S C G + Sbjct: 199 THGGGKRCEHLGCTKSAE--GKTDFCISHGGGRRCEFLEGCDKAARGRSGLCIKHGG-GK 255 Query: 141 RC 136 RC Sbjct: 256 RC 257 >At3g15820.1 68416.m02002 phosphatidic acid phosphatase-related / PAP2-related contains Pfam profile PF01569: PAP2 superfamily Length = 301 Score = 27.5 bits (58), Expect = 6.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 147 SEHLENGMAESLDERRFQEAERARVSEILN 236 S H+ M SLD RR Q A V +ILN Sbjct: 214 SGHVAGSMIASLDMRRMQRLRLAMVFDILN 243 >At2g32660.1 68415.m03992 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-4 [Lycopersicon hirsutum] gi|2808683|emb|CAA05268 Length = 589 Score = 27.5 bits (58), Expect = 6.7 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +2 Query: 56 PKTSSTPSALTYDDYGAADVGGASPRGHLRVGAPRERHGGEPGRETIPGG*ESSCLRD 229 P+ S L Y D + G P+G +G P+ G G +P E SCLR+ Sbjct: 472 PQELGRLSYLAYIDVSDNQLTGKIPQGTQIIGQPKSSFEGNSGLCGLP--LEESCLRE 527 >At1g11340.1 68414.m01302 S-locus lectin protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains S-locus glycoprotein family domain, Pfam:PF00954 Length = 901 Score = 27.5 bits (58), Expect = 6.7 Identities = 19/55 (34%), Positives = 25/55 (45%) Frame = -3 Query: 568 SLTFRSRCTPAFPCKFP*YSICTWWYCAPRHSSEWSRQRQRCRYTSQSDDQVSLK 404 S TF C P F KFP + W+ R SS +++R S+ D V LK Sbjct: 369 SKTFECTCLPGFEPKFPRH-----WFL--RDSSGGCTKKKRASICSEKDGFVKLK 416 >At5g64550.1 68418.m08112 loricrin-related contains weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 634 Score = 27.1 bits (57), Expect = 8.9 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +3 Query: 267 NLDDPCMKVHC---SAGRVCEINEHGEAICNCIKECP 368 N D + + C SAGR+ + H +C+ + CP Sbjct: 21 NFGDTALSLKCLGSSAGRLIGSSHHNHKLCSDVSNCP 57 >At5g60930.1 68418.m07643 chromosome-associated kinesin, putative microtubule-associated motor KIF4 , Mus musculus, PIR:A54803 Length = 1294 Score = 27.1 bits (57), Expect = 8.9 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = +3 Query: 120 GLPRGDISESEHLENG----MAESLDERRFQEAERARVSEIL-NESRDAPDNEINLD 275 G ISESE LENG ++ D+ + Q+ +R + +L N D P+ E N D Sbjct: 1100 GKENNSISESEALENGENSQESDEKDKGQQQQVLASRGAMLLQNALADKPEEETNDD 1156 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,364,676 Number of Sequences: 28952 Number of extensions: 236745 Number of successful extensions: 895 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 894 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1112061928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -