BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_E20 (601 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|... 34 0.018 SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces... 30 0.22 SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharom... 28 0.91 SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizos... 26 3.7 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 26 4.8 SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 26 4.8 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 25 6.4 SPAC1783.07c |pap1|caf3, caf3|transcription factor Caf3|Schizosa... 25 8.5 >SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 1752 Score = 33.9 bits (74), Expect = 0.018 Identities = 31/123 (25%), Positives = 46/123 (37%), Gaps = 2/123 (1%) Frame = +3 Query: 99 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 278 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1596 SPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1655 Query: 279 NPGQVHVVDNSGVPS-DGNSDHVVIANPDPFFSQPSNGP-SGNYEPISTGPAFVDFNHPN 452 +P S PS S +P + PS P S +Y P T P++ P+ Sbjct: 1656 SPTSPSYSPTS--PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP--TSPSYSP-TSPS 1710 Query: 453 YPP 461 Y P Sbjct: 1711 YSP 1713 Score = 33.5 bits (73), Expect = 0.024 Identities = 31/123 (25%), Positives = 46/123 (37%), Gaps = 2/123 (1%) Frame = +3 Query: 99 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 278 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1582 SPSYSPTSPSYSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1641 Query: 279 NPGQVHVVDNSGVPS-DGNSDHVVIANPDPFFSQPSNGP-SGNYEPISTGPAFVDFNHPN 452 +P S PS S +P + PS P S +Y P T P++ P+ Sbjct: 1642 SPTSPSYSPTS--PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP--TSPSYSP-TSPS 1696 Query: 453 YPP 461 Y P Sbjct: 1697 YSP 1699 Score = 32.3 bits (70), Expect = 0.056 Identities = 31/123 (25%), Positives = 45/123 (36%), Gaps = 2/123 (1%) Frame = +3 Query: 99 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 278 +P Y P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1568 SPAYMPSSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSATSPSYSPTSPSYSPTSPSY 1627 Query: 279 NPGQVHVVDNSGVPS-DGNSDHVVIANPDPFFSQPSNGP-SGNYEPISTGPAFVDFNHPN 452 +P S PS S +P + PS P S +Y P T P++ P+ Sbjct: 1628 SPTSPSYSPTS--PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP--TSPSYSP-TSPS 1682 Query: 453 YPP 461 Y P Sbjct: 1683 YSP 1685 Score = 31.1 bits (67), Expect = 0.13 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +3 Query: 99 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 278 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1659 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1718 Query: 279 NP 284 +P Sbjct: 1719 SP 1720 Score = 31.1 bits (67), Expect = 0.13 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +3 Query: 99 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 278 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1666 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1725 Query: 279 NP 284 +P Sbjct: 1726 SP 1727 Score = 31.1 bits (67), Expect = 0.13 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +3 Query: 99 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 278 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1673 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1732 Query: 279 NP 284 +P Sbjct: 1733 SP 1734 Score = 31.1 bits (67), Expect = 0.13 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +3 Query: 99 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 278 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1680 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1739 Query: 279 NP 284 +P Sbjct: 1740 SP 1741 Score = 31.1 bits (67), Expect = 0.13 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +3 Query: 99 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 278 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1687 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1746 Query: 279 NP 284 +P Sbjct: 1747 SP 1748 >SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces pombe|chr 1|||Manual Length = 576 Score = 30.3 bits (65), Expect = 0.22 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 306 NSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPI 413 N V DG + VVI P F+ P+N S N+ P+ Sbjct: 402 NHSVTGDGEAKQVVITMPSTHFT-PANNSSANHSPL 436 >SPBC30B4.04c |sol1||SWI/SNF complex subunit Sol1|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 28.3 bits (60), Expect = 0.91 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 165 VHVVD-HNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYNPGQVHVV 302 ++ +D HN + N V V+ N ++ +V+ NPD+ P + VV Sbjct: 537 INAIDVHNSEQNLLAVFVIFRNLSHFEANQNVLVQNPDFFPLLIRVV 583 Score = 25.8 bits (54), Expect = 4.8 Identities = 31/134 (23%), Positives = 54/134 (40%), Gaps = 7/134 (5%) Frame = +3 Query: 81 VHVVD-HNPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVD----HNPDYYPG 245 ++ +D HN + N V V+ N + +V+ NPD+ P + VV H Sbjct: 537 INAIDVHNSEQNLLAVFVIFRNLSHFEANQNVLVQNPDFFPLLIRVVKSLNFHATSLLRS 596 Query: 246 QVHVVDHNPDYNPGQVHVVDNSGVPSDGNSDHVV--IANPDPFFSQPSNGPSGNYEPIST 419 + +D + D + N +P+ + HV+ I + PF + S + P S Sbjct: 597 SRNTLDLHKDVLIVLCQLSQNFILPNVDVARHVLLFILSFSPFNRKKSKTILNDTLPTSI 656 Query: 420 GPAFVDFNHPNYPP 461 P++ HP P Sbjct: 657 -PSYTPATHPYAGP 669 >SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1338 Score = 26.2 bits (55), Expect = 3.7 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +3 Query: 339 HVVIANPDPFFSQPSNGPSGNY-EPISTGPAF-VDFNHPNYPPKRYDNP 479 HV ++NPD P + S NY P+ A +F+ P + +Y +P Sbjct: 478 HVSLSNPDFAIGSPMSQDSSNYSSPLHRRKASDSNFSDPRFDDLKYLSP 526 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 25.8 bits (54), Expect = 4.8 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 4/29 (13%) Frame = +3 Query: 366 FFSQPSNGP----SGNYEPISTGPAFVDF 440 F + P+N P SG+Y PI P F F Sbjct: 1560 FVTPPTNSPYAEVSGDYNPIHVSPTFAAF 1588 >SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 422 Score = 25.8 bits (54), Expect = 4.8 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 396 GNYEPI--STGPAFVDFNHPNYPPKRYDNPLAR 488 G+Y P ST P + +P+YPP Y AR Sbjct: 117 GSYPPTQPSTQPLPQSYGYPSYPPAGYRGGSAR 149 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 25.4 bits (53), Expect = 6.4 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +3 Query: 372 SQPSNGPSGNYEPISTGPAFVDFNHPNYPP 461 S P N P P+S PA + P PP Sbjct: 265 SSPPNSPPRPIAPVSMNPAINSTSKPPLPP 294 >SPAC1783.07c |pap1|caf3, caf3|transcription factor Caf3|Schizosaccharomyces pombe|chr 1|||Manual Length = 552 Score = 25.0 bits (52), Expect = 8.5 Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 4/61 (6%) Frame = +3 Query: 168 HVVDHNPDYNPGQVHVVD---HNPDYYPGQVH-VVDHNPDYNPGQVHVVDNSGVPSDGNS 335 H + N D +H +D + + +P Q++ + HN DY V G+P G Sbjct: 419 HNSNENGDLITNSLHGLDFLENANESFPEQMYPFIKHNKDYISNHPDEVPPDGLPQKGKH 478 Query: 336 D 338 D Sbjct: 479 D 479 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,520,100 Number of Sequences: 5004 Number of extensions: 57844 Number of successful extensions: 173 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -