BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_E20 (601 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.3 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 4.0 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 7.0 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 21 9.2 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 9.2 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +3 Query: 78 RVHVVDHNPDYNPGQVH----VVNYNPDYNPGQVH 170 R + + +PD + GQ+H VV Y G +H Sbjct: 897 RFYSISSSPDVHQGQIHLTVAVVQYKTQDGFGPIH 931 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -3 Query: 146 RVVIDYVHLAWIIIRVMIDHVHSVC 72 ++ ID W++ +I++V SVC Sbjct: 124 KIEIDMCDRLWVLDSGLINNVRSVC 148 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 46 SSPYWPWLPQTECTWSIITLIIIQA 120 S+P W + P TW I ++++ A Sbjct: 549 SAPVWRFQPWGPFTWGGIGVVVLFA 573 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 21.0 bits (42), Expect = 9.2 Identities = 14/56 (25%), Positives = 22/56 (39%) Frame = +3 Query: 327 GNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDNPLARGG 494 GN+ + I P P + EP + P ++ P +P R + P A G Sbjct: 71 GNNRPIYIPQPRPPHPRLRREAESEAEPGNNRPVYIPQPRPPHPRLRRE-PEAEPG 125 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/37 (24%), Positives = 17/37 (45%) Frame = +3 Query: 360 DPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRY 470 DP+F + ++ ++ +D NHP + K Y Sbjct: 171 DPWFPRHASDLDNCNHLMTKFEPDLDMNHPGFADKEY 207 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,218 Number of Sequences: 438 Number of extensions: 4543 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -