BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_E19 (324 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.6 SB_36342| Best HMM Match : Viral_helicase1 (HMM E-Value=1.1) 27 3.5 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_35067| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_50147| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_46512| Best HMM Match : TIL (HMM E-Value=1.3) 26 6.1 SB_35533| Best HMM Match : Ldl_recept_b (HMM E-Value=9.8e-05) 26 6.1 SB_40964| Best HMM Match : DUF564 (HMM E-Value=7.2) 26 6.1 SB_2295| Best HMM Match : C1_1 (HMM E-Value=2.5) 26 6.1 SB_6985| Best HMM Match : PSD2 (HMM E-Value=2) 26 8.1 SB_58730| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_58034| Best HMM Match : VWA (HMM E-Value=0) 26 8.1 >SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 28.7 bits (61), Expect = 1.1 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 163 YKQQHSKVQLPRCHDPSXPTPEI 95 Y Q+ V LP+CH P PEI Sbjct: 309 YVQEGDNVMLPKCHVTGFPLPEI 331 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 27.5 bits (58), Expect = 2.6 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -3 Query: 163 YKQQHSKVQLPRCHDPSXPTPEIVVLTLLTNIISMFPLFNICYLILII 20 + +QH + L + P PE+VV LL + +F +L+++I Sbjct: 851 FPRQHVEYALKELREEEDPRPELVVAWLLDHPEVSCTVFPTVFLVIVI 898 >SB_36342| Best HMM Match : Viral_helicase1 (HMM E-Value=1.1) Length = 872 Score = 27.1 bits (57), Expect = 3.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -2 Query: 281 LNSMHRTFRTGQAKTSMVLDSYL 213 L++ HR F+TG T+ LD+YL Sbjct: 816 LHTTHRAFQTGAKTTNWGLDAYL 838 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 26.6 bits (56), Expect = 4.6 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = -2 Query: 320 VLVVCRMY*WSIFLNSM--HRTFRTGQAKTSMVLDSYLPILLASQLIGHYT 174 V+ R+ WSI + + H +R G + S LP+ + +Q I H+T Sbjct: 1343 VMASPRIQRWSILMRAYQYHMKYRAGNQHANADCMSRLPLPVKAQQISHWT 1393 >SB_35067| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 612 Score = 26.6 bits (56), Expect = 4.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -3 Query: 133 PRCHDPSXPTPEIVVLTLLTNII 65 P HDP P P I+ +L+T+I+ Sbjct: 524 PVVHDPPAPDPPIIPDSLITSIV 546 >SB_50147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 739 Score = 26.6 bits (56), Expect = 4.6 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 4/43 (9%) Frame = +3 Query: 165 SATGVVAYQLGSQ----EDWQIGIENHTCLRLPCTKRSVHGIQ 281 + TGV A ++ S D + GI+ H C K SVHGI+ Sbjct: 554 TTTGVDAAEVASVWDVVSDRRFGIKQHPCKSARVFKGSVHGIE 596 >SB_46512| Best HMM Match : TIL (HMM E-Value=1.3) Length = 382 Score = 26.2 bits (55), Expect = 6.1 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -3 Query: 310 YAVCIDGLYF*IPCTERFVQGKRRQVWFSIPICQSSWLPS 191 YAVC + + CT FV+G R V F++ + +W+ S Sbjct: 39 YAVC-EPDHVDAECTRPFVRGSLRCVLFTLCVSPITWMLS 77 >SB_35533| Best HMM Match : Ldl_recept_b (HMM E-Value=9.8e-05) Length = 909 Score = 26.2 bits (55), Expect = 6.1 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -3 Query: 310 YAVCIDGLYF*IPCTERFVQGKRRQVWFSIPICQSSWLPS 191 YAVC + + CT FV+G R V F++ + +W+ S Sbjct: 39 YAVC-EPDHVDAECTRPFVRGSLRCVLFTLCVSPITWMLS 77 >SB_40964| Best HMM Match : DUF564 (HMM E-Value=7.2) Length = 193 Score = 26.2 bits (55), Expect = 6.1 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 208 IGR*ESRTILVFACPVRNVRCMEFRNIDHQYIRH 309 +GR E+ T L A PV N +EF +D+ I+H Sbjct: 39 MGREENVTKLFAARPVDNCSAIEFPLLDNPTIKH 72 >SB_2295| Best HMM Match : C1_1 (HMM E-Value=2.5) Length = 363 Score = 26.2 bits (55), Expect = 6.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 281 LNSMHRTFRTGQAKTSMVLDSYL 213 L+ +HR F+TG T LD YL Sbjct: 85 LHIVHRAFKTGAKTTGWNLDQYL 107 >SB_6985| Best HMM Match : PSD2 (HMM E-Value=2) Length = 254 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 245 AKTSMVLDSYLPILLASQLIGHYTCG 168 A+T V SYLPI+ Q +G+Y G Sbjct: 225 AETEPVSKSYLPIMKIGQGMGYYWVG 250 >SB_58730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1014 Score = 25.8 bits (54), Expect = 8.1 Identities = 13/54 (24%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -1 Query: 303 YVLMVYISEFHAPNVSYRASEDKYGSRF-LSANPLGFPVDRPLHLWQITNNNIQ 145 Y L +E+ A +YR + D+Y ++ + + FPVD ++ + N++ Sbjct: 712 YQLATQTAEYWASRANYRDAADQYVIQYVMPPDEYQFPVDNSVYTNVVAKLNLE 765 >SB_58034| Best HMM Match : VWA (HMM E-Value=0) Length = 1203 Score = 25.8 bits (54), Expect = 8.1 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 Query: 321 RVGGMPYVLMVYISEFHAPNVSYR 250 R+GG+P +V+I +F NV+YR Sbjct: 942 RLGGLPLSTLVFIGKF-GKNVNYR 964 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,002,626 Number of Sequences: 59808 Number of extensions: 196406 Number of successful extensions: 392 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 438034835 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -