BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_E16 (565 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13E7.05 |gpi14||pig-M|Schizosaccharomyces pombe|chr 2|||Manual 27 2.5 SPAC1250.01 |snf21|SPAC29A4.21|ATP-dependent DNA helicase Snf21|... 26 4.4 SPAC18B11.03c |||N-acetyltransferase |Schizosaccharomyces pombe|... 25 7.7 >SPBC13E7.05 |gpi14||pig-M|Schizosaccharomyces pombe|chr 2|||Manual Length = 815 Score = 26.6 bits (56), Expect = 2.5 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -3 Query: 374 LVLKYLLNINIMQHYYIYLSHFNDYIFNF-LYYLNTY 267 L++ YL ++H Y+Y D+ NF L++LN Y Sbjct: 647 LLMYYLYGSPFLEHTYLYHFGRTDHRHNFSLHHLNLY 683 >SPAC1250.01 |snf21|SPAC29A4.21|ATP-dependent DNA helicase Snf21|Schizosaccharomyces pombe|chr 1|||Manual Length = 1199 Score = 25.8 bits (54), Expect = 4.4 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 514 EAEATSPLRDELENE 470 EAEATS L D +ENE Sbjct: 1184 EAEATSQLEDRIENE 1198 >SPAC18B11.03c |||N-acetyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 440 Score = 25.0 bits (52), Expect = 7.7 Identities = 12/66 (18%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = -3 Query: 458 SDNLDSMYLLVFNNXXXXXXXXXXXIKWLV-LKYLLNINIMQHYYIYLSHFNDYIFNFLY 282 S N+D+ + +F + V L L+++N + + +Y+F++++ Sbjct: 231 SKNIDASFTSIFYSVFMLSIYYAIAKNGKVNLDMLIDVNARRFLPVAKQTMGNYVFSYVH 290 Query: 281 YLNTYK 264 +LN ++ Sbjct: 291 HLNGFQ 296 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,149,820 Number of Sequences: 5004 Number of extensions: 40695 Number of successful extensions: 77 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 238029836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -