BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_E15 (430 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g26880.1 68414.m03278 60S ribosomal protein L34 (RPL34A) iden... 119 7e-28 At1g69620.1 68414.m08008 60S ribosomal protein L34 (RPL34B) simi... 117 3e-27 At3g28900.1 68416.m03607 60S ribosomal protein L34 (RPL34C) simi... 116 5e-27 At3g19880.1 68416.m02517 F-box family protein contains Pfam prof... 29 1.0 At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transfera... 28 3.1 At1g48740.1 68414.m05454 expressed protein 28 3.1 At2g17830.1 68415.m02065 F-box family protein contains Pfam doma... 27 4.1 At4g31877.1 68417.m04530 expressed protein 27 5.4 At3g52920.2 68416.m05833 expressed protein weak similarity to en... 27 5.4 At3g52920.1 68416.m05832 expressed protein weak similarity to en... 27 5.4 At3g20710.1 68416.m02621 F-box protein-related contains weak hit... 27 5.4 At1g33410.1 68414.m04136 expressed protein 27 5.4 At5g63330.1 68418.m07948 DNA-binding bromodomain-containing prot... 27 7.1 At5g52270.1 68418.m06487 vesicle transport protein-related simil... 27 7.1 At2g36780.1 68415.m04511 UDP-glucoronosyl/UDP-glucosyl transfera... 27 7.1 At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transfera... 26 9.4 At2g36750.1 68415.m04508 UDP-glucoronosyl/UDP-glucosyl transfera... 26 9.4 At1g32585.1 68414.m04021 VQ motif-containing protein-related con... 26 9.4 >At1g26880.1 68414.m03278 60S ribosomal protein L34 (RPL34A) identical to GB:Q42351, location of EST 105E2T7, gb|T22624 Length = 120 Score = 119 bits (287), Expect = 7e-28 Identities = 60/104 (57%), Positives = 74/104 (71%), Gaps = 2/104 (1%) Frame = +2 Query: 53 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 232 MVQRL +R R SY TKSNQ RIV+TPGG+LVYQ KK P+C +++GI RP+ Sbjct: 1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPS 60 Query: 233 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 358 E RSRL ++TV R YGGVL V++RI+RAFL+EEQKIVK Sbjct: 61 EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQKIVK 104 >At1g69620.1 68414.m08008 60S ribosomal protein L34 (RPL34B) similar to SP:Q42351 from [Arabidopsis thaliana] Length = 119 Score = 117 bits (282), Expect = 3e-27 Identities = 59/104 (56%), Positives = 72/104 (69%), Gaps = 2/104 (1%) Frame = +2 Query: 53 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 232 MVQRL +R R SY TKSNQ RIV+TPGG+L YQ KK P+C +++GI RP Sbjct: 1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTKKRASGPKCPVTGKRIQGIPHLRPT 60 Query: 233 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 358 E RSRL ++TV R YGGVL V++RI+RAFL+EEQKIVK Sbjct: 61 EYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQKIVK 104 >At3g28900.1 68416.m03607 60S ribosomal protein L34 (RPL34C) similar to 60S ribosomal protein L34 GB:P41098 [Nicotiana tabacum] Length = 120 Score = 116 bits (280), Expect = 5e-27 Identities = 60/104 (57%), Positives = 72/104 (69%), Gaps = 2/104 (1%) Frame = +2 Query: 53 MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 232 MVQRL +R R SY TKSNQ RIV+TPGG+L YQ K P+C +++GI RPA Sbjct: 1 MVQRLVYRSRHSYATKSNQHRIVKTPGGKLTYQTTNKRASGPKCPVTGKRIQGIPHLRPA 60 Query: 233 E--RSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVK 358 E RSRL ++TV R YGGVL V++RIVRAFL+EEQKIVK Sbjct: 61 EYKRSRLARNERTVNRAYGGVLSGVAVRERIVRAFLVEEQKIVK 104 >At3g19880.1 68416.m02517 F-box family protein contains Pfam profile: PF00646 F-box domain Length = 389 Score = 29.5 bits (63), Expect = 1.0 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = -1 Query: 163 FLNILVYQATSRSSYYSPLV*LCVVRQTSSECKPLHHFVAQIFLISSFTTK 11 F++I +YQ + +Y + LCV R+ SS + ++ Q I++ TTK Sbjct: 77 FVSISMYQVETSQVFYCAGLLLCVTREKSSRLIIWNPYLGQTRWINTKTTK 127 >At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 27.9 bits (59), Expect = 3.1 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -2 Query: 243 RERSAGLAGWIPRSLLLH*PHLGIFLGFLTY 151 +ERS + GW P+ L+L P +G GFLT+ Sbjct: 347 KERSLLIKGWSPQMLILSHPAVG---GFLTH 374 >At1g48740.1 68414.m05454 expressed protein Length = 393 Score = 27.9 bits (59), Expect = 3.1 Identities = 14/29 (48%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +2 Query: 68 TFRRRLSYNTKSNQRRIVRTP-GGRLVYQ 151 +FR+ +S NTK + RRI+ P G LV+Q Sbjct: 130 SFRKAISENTKESFRRIISEPFPGVLVFQ 158 >At2g17830.1 68415.m02065 F-box family protein contains Pfam domain, PF00646: F-box domain Length = 394 Score = 27.5 bits (58), Expect = 4.1 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -2 Query: 195 LH*PHLGIFLGFLTYWYTKRPPGVRTILLWFDF 97 +H H G+ + TYWY G L+ FDF Sbjct: 208 IHSYHRGLSVKGNTYWYATEKHGYVNFLICFDF 240 >At4g31877.1 68417.m04530 expressed protein Length = 102 Score = 27.1 bits (57), Expect = 5.4 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 82 TSSECKPLHHFVAQIFLIS 26 +SS C P+ HF++ +F IS Sbjct: 28 SSSNCVPISHFLSHVFFIS 46 >At3g52920.2 68416.m05833 expressed protein weak similarity to enterophilin-2L [Cavia porcellus] GI:12718845; contains Pfam profile PF04949: Family of unknown function (DUF662) Length = 177 Score = 27.1 bits (57), Expect = 5.4 Identities = 21/65 (32%), Positives = 32/65 (49%) Frame = +1 Query: 187 SVQE*TTRYPAREARRAFSSLLPQEDSEARLWRCSLSQMREAAHRQSFLDRRTEDRESPK 366 + E TT+ P + +FSS + +ED E + R +LS R A R+ E RE K Sbjct: 3 TTNEATTQPPQQMMSLSFSSQMSKEDEE--MARSALSAFR--AKEDEIEKRKMEVRERVK 58 Query: 367 SATGQ 381 + G+ Sbjct: 59 AQLGR 63 >At3g52920.1 68416.m05832 expressed protein weak similarity to enterophilin-2L [Cavia porcellus] GI:12718845; contains Pfam profile PF04949: Family of unknown function (DUF662) Length = 180 Score = 27.1 bits (57), Expect = 5.4 Identities = 21/65 (32%), Positives = 32/65 (49%) Frame = +1 Query: 187 SVQE*TTRYPAREARRAFSSLLPQEDSEARLWRCSLSQMREAAHRQSFLDRRTEDRESPK 366 + E TT+ P + +FSS + +ED E + R +LS R A R+ E RE K Sbjct: 3 TTNEATTQPPQQMMSLSFSSQMSKEDEE--MARSALSAFR--AKEDEIEKRKMEVRERVK 58 Query: 367 SATGQ 381 + G+ Sbjct: 59 AQLGR 63 >At3g20710.1 68416.m02621 F-box protein-related contains weak hit to TIGRFAM TIGR01640 : F-box protein interaction domain; contains weak hit to Pfam PF00646: F-box domain Length = 362 Score = 27.1 bits (57), Expect = 5.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 Query: 177 GIFLGFLTYWYTKRPPGVRTILLWFDF 97 G+ L TYWY K + LL FDF Sbjct: 197 GVSLNGDTYWYAKDKESIDWYLLCFDF 223 >At1g33410.1 68414.m04136 expressed protein Length = 1459 Score = 27.1 bits (57), Expect = 5.4 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 190 VQE*TTRYPAREARRAFSSLLPQED 264 V E TTRYP ++ARRA L D Sbjct: 1145 VPEETTRYPVKKARRAEEEQLRSND 1169 >At5g63330.1 68418.m07948 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 477 Score = 26.6 bits (56), Expect = 7.1 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 2 VRTFCCK*RY*KNLCYKMVQRLTFRRRLSYNTKSNQ 109 +R+ CK Y L + RLTF ++YN NQ Sbjct: 208 IRSRLCKGEYSSPLDFAADVRLTFSNSIAYNPPGNQ 243 >At5g52270.1 68418.m06487 vesicle transport protein-related similar to vesicle trafficking protein sec22b [Mus musculus] GI:1907386 Length = 214 Score = 26.6 bits (56), Expect = 7.1 Identities = 13/58 (22%), Positives = 27/58 (46%) Frame = +2 Query: 35 KNLCYKMVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLR 208 K +CY + ++ R+L +N N + + + + Q + KP R G+ ++R Sbjct: 70 KKICYIALSDSSYPRKLLFNYLQNLNKELDKLDEKALIQKISKPYSFIRFGKIIGRIR 127 >At2g36780.1 68415.m04511 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 26.6 bits (56), Expect = 7.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 243 RERSAGLAGWIPRSLLLH*PHLGIFLGFLTY 151 +ER + GW P+ L+L P +G GFLT+ Sbjct: 347 KERGLLIKGWAPQVLILSHPSVG---GFLTH 374 >At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 26.2 bits (55), Expect = 9.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 243 RERSAGLAGWIPRSLLLH*PHLGIFLGFLTY 151 +ER + GW P+ L+L P +G GFLT+ Sbjct: 347 KERGLLIKGWSPQVLILSHPSVG---GFLTH 374 >At2g36750.1 68415.m04508 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 491 Score = 26.2 bits (55), Expect = 9.4 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 243 RERSAGLAGWIPRSLLLH*PHLGIFLGFLTY 151 +ER + GW P+ L+L P +G GFLT+ Sbjct: 342 KERGLLITGWSPQMLILTHPAVG---GFLTH 369 >At1g32585.1 68414.m04021 VQ motif-containing protein-related contains weak similarity to Pfma:PF05678 VQ motif Length = 220 Score = 26.2 bits (55), Expect = 9.4 Identities = 13/54 (24%), Positives = 22/54 (40%) Frame = +3 Query: 93 TQSQTKGE*YELLEVAWYTSMLRNLRRSRGVVSARVNYAVSSPRGPQSVLVSAT 254 TQS + +E +W+ + + + + S RV+Y P P S T Sbjct: 142 TQSMPQSNGFEPFPSSWFNGSTQEMHGASSLQSTRVDYEYPLPLTPNFTFSSMT 195 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,747,612 Number of Sequences: 28952 Number of extensions: 160002 Number of successful extensions: 505 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 675111616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -