BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_E08 (479 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0193 - 15492102-15492746,15492833-15492946,15493042-154933... 28 3.4 04_03_0033 + 9936723-9937019,9937621-9937754,9938966-9939329 27 6.0 >09_04_0193 - 15492102-15492746,15492833-15492946,15493042-15493332, 15493412-15493720,15493815-15494552 Length = 698 Score = 28.3 bits (60), Expect = 3.4 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = -2 Query: 133 AVILLTFIYLRDVII-FFSLLLFCNYFFLILFRIPDVKYNVYV 8 A ++L F LR +I+ F+S LFC L +F +P+ + V+V Sbjct: 491 ANLILLFFLLRKLILPFYSFTLFCVILPLTMF-VPEAELPVWV 532 >04_03_0033 + 9936723-9937019,9937621-9937754,9938966-9939329 Length = 264 Score = 27.5 bits (58), Expect = 6.0 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = -2 Query: 190 ITSSIRYDSLFKI*QLTLGAVILLTFIYLRDV---IIFFSLLLFC 65 +T S ++FKI +L LG V L +YL+ + II SLL+ C Sbjct: 88 VTLSHNEGNIFKIIKLKLGIVKLEFIVYLKIICMPIILCSLLVTC 132 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,514,512 Number of Sequences: 37544 Number of extensions: 129993 Number of successful extensions: 199 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 199 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 991020332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -