BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_E05 (574 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19406| Best HMM Match : DUF706 (HMM E-Value=2.8e-31) 179 1e-45 SB_23154| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.041 SB_14324| Best HMM Match : Ank (HMM E-Value=1.7e-28) 30 1.2 SB_26203| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_57338| Best HMM Match : VWA (HMM E-Value=1.2) 29 2.0 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 29 2.7 SB_11581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_8672| Best HMM Match : PKD_channel (HMM E-Value=1.4e-38) 29 3.6 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 28 6.2 SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_34106| Best HMM Match : Acetyltransf_1 (HMM E-Value=1.1e-10) 28 6.2 SB_54916| Best HMM Match : TB2_DP1_HVA22 (HMM E-Value=4.76441e-44) 27 8.2 SB_8915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_19406| Best HMM Match : DUF706 (HMM E-Value=2.8e-31) Length = 203 Score = 179 bits (436), Expect = 1e-45 Identities = 88/181 (48%), Positives = 119/181 (65%), Gaps = 12/181 (6%) Frame = +2 Query: 53 VSVMDPSLLLRPEEKYE------------DKPLEAFRDYTVDENDPIKMRVRKTYYDMHT 196 + + DPS L RPEE+Y+ DK E FR+Y ++ + VR+TY MH Sbjct: 24 IVLTDPSQLHRPEEQYQEFNKKKKEISRTDKSKEEFRNYNINLQTDV---VRETYKLMHK 80 Query: 197 NMTVDFVKGKMDNWLKFNHFKSTIKDALIKLNDLVDESDPDTNLPNIVHAFQTAERIRED 376 TV+FV+ K+ W + + T+ +A+ L+ LVDESDPDT+LPN HAFQTAERIR D Sbjct: 81 YQTVEFVQQKIKKWGSLSKTEMTVMEAVFMLDALVDESDPDTDLPNSAHAFQTAERIRAD 140 Query: 377 HPDDDWFHLIGLIHDLGKVMAFYEEPQWCVVGDTFAVGCKWGKSIVYGDDSFKYNPDTYY 556 HPD DWF L+GL+HD+GKV+A + +PQWCVVGDTF VGC++ V+ ++F+ NPDT Sbjct: 141 HPDKDWFQLVGLLHDMGKVLALWGDPQWCVVGDTFPVGCQFSNKNVF-PETFEDNPDTKV 199 Query: 557 P 559 P Sbjct: 200 P 200 >SB_23154| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1051 Score = 35.1 bits (77), Expect = 0.041 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 1/86 (1%) Frame = +2 Query: 128 DYTVDENDPIKMRVRKTYYDMHTNMTVDFVKGKMDNWLKFNHFKSTIKDALIKLNDLVDE 307 +Y + NDP+ + + +T+ D+V + D+W+ F+H D K+N+ + Sbjct: 259 NYGLSTNDPLSIGILLIILVFNTSNNNDYVSDESDDWVPFDH------DGRRKINNNYES 312 Query: 308 SDPDTN-LPNIVHAFQTAERIREDHP 382 D DT+ L ++ E + D P Sbjct: 313 YDSDTSMLSDLDGESDEEEEVNRDAP 338 >SB_14324| Best HMM Match : Ank (HMM E-Value=1.7e-28) Length = 631 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/94 (22%), Positives = 43/94 (45%) Frame = +2 Query: 56 SVMDPSLLLRPEEKYEDKPLEAFRDYTVDENDPIKMRVRKTYYDMHTNMTVDFVKGKMDN 235 ++ P+L +RP +KY+ + A R Y ++ P + + D + +K + Sbjct: 510 ALQKPTLEIRPNQKYDW--ITAIRAYGIELKSPPEPSPHMSAGDPLKDDATMVLKQQR-- 565 Query: 236 WLKFNHFKSTIKDALIKLNDLVDESDPDTNLPNI 337 ++ +STI + LN + D+ T +PN+ Sbjct: 566 -MRIKELQSTINQQTVLLNSICDQLQKLTGVPNM 598 >SB_26203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 136 RVITERFQRFVLVFLLWSE*KRRVHNGHR 50 R++ F RFV FL W + K+ +GHR Sbjct: 56 RIVVHYFLRFVFFFLGWWKVKQNARDGHR 84 >SB_57338| Best HMM Match : VWA (HMM E-Value=1.2) Length = 333 Score = 29.5 bits (63), Expect = 2.0 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = -1 Query: 232 IHFTLDEINCHVRVHIIIGFTDSHLDRIVFIHRVITERFQ 113 IH T NC R H G TD H VF HR++TE F+ Sbjct: 260 IHCT--SFNCDDRFHRCQGDTDGH----VFAHRLLTEGFR 293 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 29.1 bits (62), Expect = 2.7 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 9/107 (8%) Frame = +2 Query: 101 EDKPLEAFRDYTVDE--NDPIKMRVRKTYYD---MHTNMTVDFVKGKMDNWLKFNHFKST 265 E K L A +++ ND +K+++R D N + ++ K +N L ++ Sbjct: 1209 EQKKLNANYQKDIEDLLNDIVKLKMRGMDDDGTEEMENQIREELEVKQENKLLQEQVENL 1268 Query: 266 IKDALIKLNDLVDESDPDTNLP----NIVHAFQTAERIREDHPDDDW 394 IKD + D D+S N+ + + ++ E+ PDDDW Sbjct: 1269 IKDNALLQKDNTDKSTEIQNMELEIKRLENIVSDLQKELENRPDDDW 1315 >SB_11581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 29.1 bits (62), Expect = 2.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +2 Query: 170 RKTYYDMHTNMTVDFVKGKMDNWLKFNH 253 R+ Y + +TN D+V + D+W+ F+H Sbjct: 5 RRRYRNTNTNNKNDYVSDESDDWVPFDH 32 >SB_8672| Best HMM Match : PKD_channel (HMM E-Value=1.4e-38) Length = 1523 Score = 28.7 bits (61), Expect = 3.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 140 PPCNHGTLPTVCPRIS 93 PPC+ GTLP +C + S Sbjct: 33 PPCSEGTLPEICKKTS 48 >SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) Length = 506 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +3 Query: 402 SLDSFTISERLWPSTRSRNGA--WSVTHSPS 488 S +SFTI+ LWPS+ N W++ SP+ Sbjct: 397 SNNSFTITSPLWPSSPPSNTTCNWAIESSPN 427 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 27.9 bits (59), Expect = 6.2 Identities = 17/69 (24%), Positives = 30/69 (43%) Frame = +2 Query: 182 YDMHTNMTVDFVKGKMDNWLKFNHFKSTIKDALIKLNDLVDESDPDTNLPNIVHAFQTAE 361 YD + N D V+ + F+ T+ A IK +DE ++ PN + E Sbjct: 307 YDTNKNDEGDAVQHPVHTTTNSVCFQHTLHTAKIKAGH-IDEPTHSSSFPNRLQGTAQVE 365 Query: 362 RIREDHPDD 388 R+ + P++ Sbjct: 366 RLEQQQPEE 374 >SB_34106| Best HMM Match : Acetyltransf_1 (HMM E-Value=1.1e-10) Length = 262 Score = 27.9 bits (59), Expect = 6.2 Identities = 17/73 (23%), Positives = 27/73 (36%) Frame = +2 Query: 32 KIKPESPVSVMDPSLLLRPEEKYEDKPLEAFRDYTVDENDPIKMRVRKTYYDMHTNMTVD 211 K PE + DPS + E + D + E P + V T M Sbjct: 105 KRTPEKRIQKSDPSPGILSNEDFTDLDYNTMMASLIGEEQPPLIAVSDTPAIMEVESLCS 164 Query: 212 FVKGKMDNWLKFN 250 ++G +D +K+N Sbjct: 165 LIRGGVDEDVKYN 177 >SB_54916| Best HMM Match : TB2_DP1_HVA22 (HMM E-Value=4.76441e-44) Length = 210 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +2 Query: 257 KSTIKDALIKLNDLVDESDPDTNLPNIVHAFQTAERIREDHPDDD 391 +S I L K+ + +D+ + +LP +VH E IR P D Sbjct: 155 QSQIDSTLEKVGEKMDKYAKEADLPRLVHGSCLVEWIRHSVPKGD 199 >SB_8915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 27.5 bits (58), Expect = 8.2 Identities = 41/142 (28%), Positives = 65/142 (45%), Gaps = 11/142 (7%) Frame = +2 Query: 38 KPESPVSVMDPSLLLRPEEKYEDKPLEAFRD-YTVDENDPIKMRVRK--TYY----DMHT 196 KP SP S+ S + + E K + F D Y ++ D ++ + K YY D + Sbjct: 140 KP-SPSSIDFDSKKVAEYQSSEGKKIFVFDDLYDKEDLDNLRAHILKYGVYYFDDSDDNE 198 Query: 197 NMTVDFVKG-KMDNWLKFNHFKSTIKDAL-IKLNDLVDESDPDTNLPNIVHAFQTAERIR 370 + V ++ G +DN+LK + T + A + ++ D NL I +A T RI Sbjct: 199 SDNVQWIAGFNIDNYLKSRFWNITHRVATHVSGSNKWFPYDISCNL--IRYADHT--RIH 254 Query: 371 ED--HPDDDWFHLIGLIHDLGK 430 D +D+W HLI L D+ K Sbjct: 255 HDCNQNEDEWTHLIYLNPDMEK 276 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,791,120 Number of Sequences: 59808 Number of extensions: 419221 Number of successful extensions: 1333 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1328 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1361520496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -