BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_E04 (541 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC024300-1|AAH24300.1| 605|Homo sapiens FSTL4 protein protein. 33 0.48 AY396740-1|AAR91618.1| 86|Homo sapiens serine protease inhibit... 33 0.84 M19481-1|AAA35851.1| 317|Homo sapiens protein ( Human follistat... 32 1.1 BC004107-1|AAH04107.1| 344|Homo sapiens follistatin protein. 32 1.1 U76702-1|AAC64321.1| 263|Homo sapiens follistatin-related prote... 32 1.5 BC033119-1|AAH33119.1| 263|Homo sapiens follistatin-like 3 (sec... 32 1.5 BC005839-1|AAH05839.1| 263|Homo sapiens follistatin-like 3 (sec... 32 1.5 AY358917-1|AAQ89276.1| 263|Homo sapiens FSTL3 protein. 32 1.5 BC139755-1|AAI39756.1| 793|Homo sapiens SLCO5A1 protein protein. 31 2.6 AF205075-1|AAG42207.1| 848|Homo sapiens organic anion transport... 31 2.6 X57655-1|CAB37834.1| 84|Homo sapiens acrosin-trypsin inhibitor... 31 3.4 M91438-1|AAB59431.1| 84|Homo sapiens serine proteinase inhibit... 31 3.4 CR542135-1|CAG46932.1| 84|Homo sapiens bitor); complete cds, w... 31 3.4 BC032003-1|AAH32003.1| 80|Homo sapiens serine peptidase inhibi... 31 3.4 BC022514-1|AAH22514.1| 84|Homo sapiens serine peptidase inhibi... 31 3.4 AY358716-1|AAQ89078.1| 80|Homo sapiens protease inhibitor H pr... 31 3.4 CR541813-1|CAG46612.1| 317|Homo sapiens FST protein. 30 4.5 U06863-1|AAA66062.1| 308|Homo sapiens follistatin-related prote... 30 6.0 D89937-1|BAA28707.1| 308|Homo sapiens follistatin-related prote... 30 6.0 BC000055-1|AAH00055.1| 308|Homo sapiens follistatin-like 1 prot... 30 6.0 AB119283-1|BAD12167.1| 308|Homo sapiens follistatin-related pro... 30 6.0 >BC024300-1|AAH24300.1| 605|Homo sapiens FSTL4 protein protein. Length = 605 Score = 33.5 bits (73), Expect = 0.48 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +2 Query: 392 KCAENCISTPEYNPVCGSDXQTYKNQARLFCAPXL 496 +C E C P Y PVCGSD + Y+N +L A L Sbjct: 88 QCLEAC--RPSYVPVCGSDGRFYENHCKLHRAACL 120 >AY396740-1|AAR91618.1| 86|Homo sapiens serine protease inhibitor Kazal type 9 protein. Length = 86 Score = 32.7 bits (71), Expect = 0.84 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 425 YNPVCGSDXQTYKNQARLFCA 487 Y+P+CGSD +TYKN FC+ Sbjct: 50 YDPICGSDGKTYKNDC-FFCS 69 >M19481-1|AAA35851.1| 317|Homo sapiens protein ( Human follistatin gene, exon 6. ). Length = 317 Score = 32.3 bits (70), Expect = 1.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 395 CAENCISTPEYNPVCGSDXQTYKNQARLFCA 487 CA +C + PVCG D +TY+N+ L A Sbjct: 118 CAPDCSNITWKGPVCGLDGKTYRNECALLKA 148 >BC004107-1|AAH04107.1| 344|Homo sapiens follistatin protein. Length = 344 Score = 32.3 bits (70), Expect = 1.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 395 CAENCISTPEYNPVCGSDXQTYKNQARLFCA 487 CA +C + PVCG D +TY+N+ L A Sbjct: 118 CAPDCSNITWKGPVCGLDGKTYRNECALLKA 148 >U76702-1|AAC64321.1| 263|Homo sapiens follistatin-related protein FLRG protein. Length = 263 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 392 KCAENCISTPEYNPVCGSDXQTYKNQARLFCA 487 +CA +C P VCGSD TY+++ L A Sbjct: 120 ECAPDCSGLPARLQVCGSDGATYRDECELRAA 151 >BC033119-1|AAH33119.1| 263|Homo sapiens follistatin-like 3 (secreted glycoprotein) protein. Length = 263 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 392 KCAENCISTPEYNPVCGSDXQTYKNQARLFCA 487 +CA +C P VCGSD TY+++ L A Sbjct: 120 ECAPDCSGLPARLQVCGSDGATYRDECELRAA 151 >BC005839-1|AAH05839.1| 263|Homo sapiens follistatin-like 3 (secreted glycoprotein) protein. Length = 263 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 392 KCAENCISTPEYNPVCGSDXQTYKNQARLFCA 487 +CA +C P VCGSD TY+++ L A Sbjct: 120 ECAPDCSGLPARLQVCGSDGATYRDECELRAA 151 >AY358917-1|AAQ89276.1| 263|Homo sapiens FSTL3 protein. Length = 263 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 392 KCAENCISTPEYNPVCGSDXQTYKNQARLFCA 487 +CA +C P VCGSD TY+++ L A Sbjct: 120 ECAPDCSGLPARLQVCGSDGATYRDECELRAA 151 >BC139755-1|AAI39756.1| 793|Homo sapiens SLCO5A1 protein protein. Length = 793 Score = 31.1 bits (67), Expect = 2.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 377 RQTIEKCAENC-ISTPEYNPVCGSDXQTYKNQARLFC 484 R C NC EY PVCGSD TY N C Sbjct: 494 RNLTGSCNVNCGCKIHEYEPVCGSDGITYFNPCLAGC 530 >AF205075-1|AAG42207.1| 848|Homo sapiens organic anion transporter polypeptide-related protein 4 protein. Length = 848 Score = 31.1 bits (67), Expect = 2.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 377 RQTIEKCAENC-ISTPEYNPVCGSDXQTYKNQARLFC 484 R C NC EY PVCGSD TY N C Sbjct: 549 RNLTGSCNVNCGCKIHEYEPVCGSDGITYFNPCLAGC 585 >X57655-1|CAB37834.1| 84|Homo sapiens acrosin-trypsin inhibitor, HUSI-II protein. Length = 84 Score = 30.7 bits (66), Expect = 3.4 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 425 YNPVCGSDXQTYKNQARL 478 +NPVCGSD TY N+ L Sbjct: 48 FNPVCGSDMSTYANECTL 65 >M91438-1|AAB59431.1| 84|Homo sapiens serine proteinase inhibitor protein. Length = 84 Score = 30.7 bits (66), Expect = 3.4 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 425 YNPVCGSDXQTYKNQARL 478 +NPVCGSD TY N+ L Sbjct: 48 FNPVCGSDMSTYANECTL 65 >CR542135-1|CAG46932.1| 84|Homo sapiens bitor); complete cds, without stopcodon. protein. Length = 84 Score = 30.7 bits (66), Expect = 3.4 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 425 YNPVCGSDXQTYKNQARL 478 +NPVCGSD TY N+ L Sbjct: 48 FNPVCGSDMSTYANECTL 65 >BC032003-1|AAH32003.1| 80|Homo sapiens serine peptidase inhibitor, Kazal type 6 protein. Length = 80 Score = 30.7 bits (66), Expect = 3.4 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +2 Query: 416 TPEYNPVCGSDXQTYKNQARLFCAPXLWSSSDFGQASP 529 T E NP CGSD QTY N+ FC + S P Sbjct: 41 TRESNPHCGSDGQTYGNKC-AFCKAIVKSGGKISLKHP 77 >BC022514-1|AAH22514.1| 84|Homo sapiens serine peptidase inhibitor, Kazal type 2 (acrosin-trypsin inhibitor) protein. Length = 84 Score = 30.7 bits (66), Expect = 3.4 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 425 YNPVCGSDXQTYKNQARL 478 +NPVCGSD TY N+ L Sbjct: 48 FNPVCGSDMSTYANECTL 65 >AY358716-1|AAQ89078.1| 80|Homo sapiens protease inhibitor H protein. Length = 80 Score = 30.7 bits (66), Expect = 3.4 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +2 Query: 416 TPEYNPVCGSDXQTYKNQARLFCAPXLWSSSDFGQASP 529 T E NP CGSD QTY N+ FC + S P Sbjct: 41 TRESNPHCGSDGQTYGNKC-AFCKAIVKSGGKISLKHP 77 >CR541813-1|CAG46612.1| 317|Homo sapiens FST protein. Length = 317 Score = 30.3 bits (65), Expect = 4.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 395 CAENCISTPEYNPVCGSDXQTYKNQARLFCA 487 CA +C + PVCG D +TY N+ L A Sbjct: 118 CAPDCSNITWKGPVCGLDGKTYCNECALLKA 148 >U06863-1|AAA66062.1| 308|Homo sapiens follistatin-related protein precursor protein. Length = 308 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 395 CAENCISTPEYNPVCGSDXQTYKNQARL 478 C E C P PVCGS+ +TY N L Sbjct: 54 CIEQC--KPHKRPVCGSNGKTYLNHCEL 79 >D89937-1|BAA28707.1| 308|Homo sapiens follistatin-related protein (FRP) protein. Length = 308 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 395 CAENCISTPEYNPVCGSDXQTYKNQARL 478 C E C P PVCGS+ +TY N L Sbjct: 54 CIEQC--KPHKRPVCGSNGKTYLNHCEL 79 >BC000055-1|AAH00055.1| 308|Homo sapiens follistatin-like 1 protein. Length = 308 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 395 CAENCISTPEYNPVCGSDXQTYKNQARL 478 C E C P PVCGS+ +TY N L Sbjct: 54 CIEQC--KPHKRPVCGSNGKTYLNHCEL 79 >AB119283-1|BAD12167.1| 308|Homo sapiens follistatin-related protein protein. Length = 308 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 395 CAENCISTPEYNPVCGSDXQTYKNQARL 478 C E C P PVCGS+ +TY N L Sbjct: 54 CIEQC--KPHKRPVCGSNGKTYLNHCEL 79 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,248,394 Number of Sequences: 237096 Number of extensions: 1829175 Number of successful extensions: 10575 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 10461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10575 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5251598958 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -