BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_E03 (502 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000D560E4 Cluster: PREDICTED: similar to Inter-alph... 148 6e-35 UniRef50_UPI0000D56533 Cluster: PREDICTED: similar to Inter-alph... 141 7e-33 UniRef50_UPI0000D560E0 Cluster: PREDICTED: similar to Inter-alph... 111 6e-24 UniRef50_Q5T665 Cluster: Inter-alpha inhibitor H5; n=34; Tetrapo... 110 1e-23 UniRef50_Q5RHF3 Cluster: Novel protein similar to vertebrate int... 109 5e-23 UniRef50_UPI000065DA1D Cluster: Homolog of Homo sapiens "Inter-a... 104 1e-21 UniRef50_UPI000155CC23 Cluster: PREDICTED: similar to ITI-like p... 103 2e-21 UniRef50_Q6UXX5 Cluster: Inter-alpha-trypsin inhibitor heavy cha... 103 2e-21 UniRef50_Q4SBF6 Cluster: Chromosome 11 SCAF14674, whole genome s... 102 4e-21 UniRef50_UPI0000E25D56 Cluster: PREDICTED: inter-alpha (globulin... 100 2e-20 UniRef50_Q4SBF5 Cluster: Chromosome 11 SCAF14674, whole genome s... 99 3e-20 UniRef50_UPI000065F8E3 Cluster: inter-alpha (globulin) inhibitor... 96 5e-19 UniRef50_Q4S685 Cluster: Chromosome 9 SCAF14729, whole genome sh... 95 1e-18 UniRef50_Q6PGW2 Cluster: Zgc:112265 protein; n=11; Clupeocephala... 93 2e-18 UniRef50_Q503P4 Cluster: Zgc:110377; n=9; Euteleostomi|Rep: Zgc:... 93 2e-18 UniRef50_UPI0000E460BF Cluster: PREDICTED: similar to inter-alph... 92 6e-18 UniRef50_P19823 Cluster: Inter-alpha-trypsin inhibitor heavy cha... 92 7e-18 UniRef50_UPI0000D8C94A Cluster: Novel protein similar to vertebr... 91 1e-17 UniRef50_Q14624 Cluster: Inter-alpha-trypsin inhibitor heavy cha... 90 3e-17 UniRef50_UPI0000E47594 Cluster: PREDICTED: similar to inter-alph... 89 5e-17 UniRef50_UPI0000E1FD23 Cluster: PREDICTED: inter-alpha (globulin... 88 9e-17 UniRef50_P19827 Cluster: Inter-alpha-trypsin inhibitor heavy cha... 88 9e-17 UniRef50_UPI0000F2DDBB Cluster: PREDICTED: similar to Inter-alph... 88 1e-16 UniRef50_Q498Q0 Cluster: Zgc:113924; n=5; Danio rerio|Rep: Zgc:1... 87 2e-16 UniRef50_P79263 Cluster: Inter-alpha-trypsin inhibitor heavy cha... 86 4e-16 UniRef50_UPI00005843FB Cluster: PREDICTED: hypothetical protein;... 82 8e-15 UniRef50_UPI0000E46E0F Cluster: PREDICTED: similar to LOC594926 ... 81 2e-14 UniRef50_UPI00006A1915 Cluster: Transmembrane protein 110.; n=4;... 77 2e-13 UniRef50_UPI000058940A Cluster: PREDICTED: similar to inter-alph... 76 5e-13 UniRef50_UPI000065D60D Cluster: inter-alpha trypsin inhibitor he... 73 3e-12 UniRef50_UPI0000EB3907 Cluster: Transmembrane protein 110.; n=3;... 72 6e-12 UniRef50_A3ZZ07 Cluster: Inter-alpha-trypsin inhibitor family he... 62 7e-09 UniRef50_Q60ED8 Cluster: Von Willebrand factor type A domain con... 58 1e-07 UniRef50_A3AIY9 Cluster: Putative uncharacterized protein; n=1; ... 58 1e-07 UniRef50_Q4S5G0 Cluster: Chromosome 19 SCAF14731, whole genome s... 56 6e-07 UniRef50_UPI0000D9F467 Cluster: PREDICTED: trophinin; n=2; Catar... 54 1e-06 UniRef50_Q82LZ6 Cluster: Putative uncharacterized protein; n=1; ... 54 2e-06 UniRef50_Q3IHK0 Cluster: Putative uncharacterized protein; n=2; ... 54 2e-06 UniRef50_A7HVH6 Cluster: Vault protein inter-alpha-trypsin domai... 53 4e-06 UniRef50_A4C730 Cluster: Putative uncharacterized protein; n=1; ... 53 4e-06 UniRef50_UPI0000E87C0D Cluster: hypothetical protein MB2181_0537... 51 1e-05 UniRef50_Q21PJ3 Cluster: Von Willebrand factor, type A; n=1; Sac... 51 1e-05 UniRef50_Q1VY89 Cluster: Inter-alpha-trypsin inhibitor family he... 51 2e-05 UniRef50_Q0AMP5 Cluster: Vault protein inter-alpha-trypsin domai... 51 2e-05 UniRef50_A6X8G3 Cluster: LPXTG-motif cell wall anchor domain pro... 50 2e-05 UniRef50_Q8YNZ7 Cluster: Alr4412 protein; n=4; Cyanobacteria|Rep... 50 4e-05 UniRef50_A5UYN7 Cluster: von Willebrand factor, type A; n=1; Ros... 49 5e-05 UniRef50_A0YYN3 Cluster: Von Willebrand factor, type A; n=1; Lyn... 49 5e-05 UniRef50_Q9LMB7 Cluster: F14D16.26; n=5; Magnoliophyta|Rep: F14D... 49 5e-05 UniRef50_A1U6Y4 Cluster: Vault protein inter-alpha-trypsin domai... 49 7e-05 UniRef50_Q09E12 Cluster: Inter-alpha-inhibitor H4 heavy chain, p... 48 1e-04 UniRef50_A5UTA6 Cluster: von Willebrand factor, type A; n=5; Chl... 48 1e-04 UniRef50_A0P2E4 Cluster: Von Willebrand factor type A like domai... 48 2e-04 UniRef50_Q89VR8 Cluster: Bll0977 protein; n=3; Rhizobiales|Rep: ... 47 2e-04 UniRef50_A6PIB9 Cluster: Vault protein inter-alpha-trypsin domai... 47 2e-04 UniRef50_A5E9T8 Cluster: Putative uncharacterized protein; n=2; ... 47 2e-04 UniRef50_Q7ULL3 Cluster: Putative uncharacterized protein; n=1; ... 47 3e-04 UniRef50_Q4S6B8 Cluster: Chromosome 9 SCAF14729, whole genome sh... 46 4e-04 UniRef50_A2Y022 Cluster: Putative uncharacterized protein; n=1; ... 46 4e-04 UniRef50_A4J6Q3 Cluster: Von Willebrand factor, type A; n=1; Des... 46 5e-04 UniRef50_Q1DE81 Cluster: Von Willebrand factor type A domain pro... 46 6e-04 UniRef50_Q1NTK1 Cluster: Von Willebrand factor, type A; n=3; cel... 45 8e-04 UniRef50_Q2SQR4 Cluster: Uncharacterized protein containing a vo... 45 0.001 UniRef50_Q0AV90 Cluster: Putative uncharacterized protein; n=1; ... 45 0.001 UniRef50_A5NZ29 Cluster: LPXTG-motif cell wall anchor domain pre... 45 0.001 UniRef50_A7PDU4 Cluster: Chromosome chr11 scaffold_13, whole gen... 45 0.001 UniRef50_A7RKA1 Cluster: Predicted protein; n=2; Nematostella ve... 45 0.001 UniRef50_UPI0000EB3B8C Cluster: Novel protein.; n=2; Canis lupus... 44 0.001 UniRef50_Q4RV83 Cluster: Chromosome 15 SCAF14992, whole genome s... 44 0.001 UniRef50_Q083T9 Cluster: Vault protein inter-alpha-trypsin domai... 44 0.001 UniRef50_Q2QSE5 Cluster: Von Willebrand factor type A domain con... 44 0.001 UniRef50_Q47YR5 Cluster: Von Willebrand factor type A domain pro... 44 0.002 UniRef50_Q1YZ74 Cluster: Inter-alpha-trypsin inhibitor domain pr... 44 0.002 UniRef50_A6F3R5 Cluster: Putative uncharacterized protein; n=1; ... 44 0.002 UniRef50_Q10RY0 Cluster: Zinc finger family protein, putative, e... 44 0.002 UniRef50_Q7UL83 Cluster: Inter-alpha-trypsin inhibitor family he... 44 0.003 UniRef50_Q21MJ3 Cluster: Von Willebrand factor, type A; n=1; Sac... 44 0.003 UniRef50_Q6ZFR3 Cluster: Zinc finger (C3HC4-type RING finger) pr... 44 0.003 UniRef50_Q3A188 Cluster: Von Willebrand factor type A domain pro... 43 0.003 UniRef50_Q15NW6 Cluster: Vault protein inter-alpha-trypsin; n=1;... 43 0.003 UniRef50_A1S752 Cluster: Inter-alpha-trypsin inhibitor domain pr... 43 0.003 UniRef50_Q9FF49 Cluster: Retroelement pol polyprotein-like; n=18... 43 0.003 UniRef50_A7QCT4 Cluster: Chromosome undetermined scaffold_79, wh... 43 0.003 UniRef50_A5B5Z1 Cluster: Putative uncharacterized protein; n=1; ... 43 0.003 UniRef50_Q8YP40 Cluster: Alr4360 protein; n=8; Nostocaceae|Rep: ... 43 0.004 UniRef50_Q8H923 Cluster: Putative uncharacterized protein OSJNBa... 43 0.004 UniRef50_Q7G2L9 Cluster: Von Willebrand factor type A domain con... 43 0.004 UniRef50_Q231J4 Cluster: Von Willebrand factor type A domain con... 43 0.004 UniRef50_Q22X70 Cluster: Von Willebrand factor type A domain con... 43 0.004 UniRef50_A6GAI6 Cluster: Putative uncharacterized protein; n=1; ... 42 0.006 UniRef50_A6G415 Cluster: von Willebrand factor, type A; n=1; Ple... 42 0.006 UniRef50_A6G2V8 Cluster: von Willebrand factor, type A; n=1; Ple... 42 0.006 UniRef50_Q9LN03 Cluster: T6D22.13; n=2; Arabidopsis thaliana|Rep... 42 0.006 UniRef50_UPI0000F2D28F Cluster: PREDICTED: hypothetical protein;... 42 0.008 UniRef50_Q1JWY1 Cluster: Von Willebrand factor, type A precursor... 42 0.008 UniRef50_Q10ZP7 Cluster: Von Willebrand factor, type A; n=1; Tri... 42 0.008 UniRef50_A3W9L9 Cluster: Putative uncharacterized protein; n=2; ... 42 0.008 UniRef50_A0X7B2 Cluster: LPXTG-motif cell wall anchor domain pre... 42 0.008 UniRef50_A0JAF2 Cluster: Vault protein inter-alpha-trypsin precu... 42 0.010 UniRef50_Q24CQ9 Cluster: Von Willebrand factor type A domain con... 42 0.010 UniRef50_A0CDA1 Cluster: Chromosome undetermined scaffold_17, wh... 42 0.010 UniRef50_UPI0000E105CF Cluster: hypothetical protein OM2255_1460... 41 0.014 UniRef50_Q2BJ22 Cluster: Putative uncharacterized protein; n=1; ... 41 0.014 UniRef50_Q7SGD8 Cluster: Putative uncharacterized protein NCU009... 41 0.014 UniRef50_UPI00006CC94A Cluster: von Willebrand factor type A dom... 41 0.018 UniRef50_Q8EF10 Cluster: Inter-alpha-trypsin inhibitor domain pr... 41 0.018 UniRef50_Q7JMF9 Cluster: Putative uncharacterized protein tag-18... 41 0.018 UniRef50_Q0M4B8 Cluster: Von Willebrand factor, type A precursor... 40 0.024 UniRef50_Q54DU5 Cluster: Putative uncharacterized protein; n=1; ... 40 0.024 UniRef50_Q24FW2 Cluster: Von Willebrand factor type A domain con... 40 0.024 UniRef50_P34374 Cluster: Voltage-dependent calcium channel unc-3... 40 0.024 UniRef50_Q7NFR7 Cluster: Gll3457 protein; n=4; Cyanobacteria|Rep... 40 0.031 UniRef50_A4IRF6 Cluster: Putative uncharacterized protein; n=1; ... 40 0.031 UniRef50_A4EE97 Cluster: Von Willebrand factor, type A; n=5; Rho... 40 0.031 UniRef50_Q9ZQ46 Cluster: Copia-like retroelement pol polyprotein... 40 0.031 UniRef50_Q22SJ4 Cluster: Von Willebrand factor type A domain con... 40 0.031 UniRef50_A7RTF3 Cluster: Predicted protein; n=2; Nematostella ve... 40 0.031 UniRef50_A0CY84 Cluster: Chromosome undetermined scaffold_307, w... 40 0.031 UniRef50_Q0URV5 Cluster: Putative uncharacterized protein; n=1; ... 40 0.031 UniRef50_A5UWY7 Cluster: von Willebrand factor, type A; n=5; Chl... 40 0.042 UniRef50_A1ZUW0 Cluster: Von Willebrand factor, type A; n=1; Mic... 40 0.042 UniRef50_Q2V3P2 Cluster: Uncharacterized protein At3g54780.3; n=... 40 0.042 UniRef50_Q54MG1 Cluster: Type A von Willebrand factor domain-con... 40 0.042 UniRef50_A7SFM5 Cluster: Predicted protein; n=1; Nematostella ve... 40 0.042 UniRef50_A0E9B3 Cluster: Chromosome undetermined scaffold_84, wh... 40 0.042 UniRef50_UPI00015B5333 Cluster: PREDICTED: similar to ENSANGP000... 39 0.055 UniRef50_Q2I6M5 Cluster: VIT-vWFA-RpoN multidomain protein; n=1;... 39 0.055 UniRef50_A6TP10 Cluster: von Willebrand factor, type A; n=1; Alk... 39 0.055 UniRef50_A6EQD3 Cluster: von Willebrand factor type A like domai... 39 0.055 UniRef50_Q233P3 Cluster: Von Willebrand factor type A domain con... 39 0.055 UniRef50_UPI00006CD16B Cluster: von Willebrand factor type A dom... 39 0.073 UniRef50_A2AVD6 Cluster: Novel protein; n=5; Eutheria|Rep: Novel... 39 0.073 UniRef50_Q28U54 Cluster: von Willebrand factor type A; n=1; Jann... 39 0.073 UniRef50_A3QDW1 Cluster: Vault protein inter-alpha-trypsin domai... 39 0.073 UniRef50_A1ZFT4 Cluster: Von Willebrand factor, type A; n=1; Mic... 39 0.073 UniRef50_Q23JA0 Cluster: Von Willebrand factor type A domain con... 39 0.073 UniRef50_A0DZ93 Cluster: Chromosome undetermined scaffold_7, who... 39 0.073 UniRef50_UPI0000EBE040 Cluster: PREDICTED: similar to voltage-ga... 38 0.096 UniRef50_UPI00006CAF43 Cluster: von Willebrand factor type A dom... 38 0.096 UniRef50_A7RNW3 Cluster: Predicted protein; n=1; Nematostella ve... 38 0.096 UniRef50_Q5V2Z1 Cluster: Von Willebrand factor type A like metal... 38 0.096 UniRef50_UPI0000D577A5 Cluster: PREDICTED: similar to CG4587-PA;... 38 0.13 UniRef50_Q7NTS8 Cluster: Putative uncharacterized protein; n=1; ... 38 0.13 UniRef50_A0PNR0 Cluster: Putative uncharacterized protein; n=1; ... 38 0.13 UniRef50_A7R324 Cluster: Chromosome chr7 scaffold_476, whole gen... 38 0.13 UniRef50_Q23FU3 Cluster: Von Willebrand factor type A domain con... 38 0.13 UniRef50_Q8YW34 Cluster: All1782 protein; n=4; Cyanobacteria|Rep... 38 0.17 UniRef50_Q6ZED8 Cluster: Slr7060 protein; n=1; Synechocystis sp.... 38 0.17 UniRef50_Q7PM11 Cluster: ENSANGP00000004592; n=1; Anopheles gamb... 38 0.17 UniRef50_Q7K0H4 Cluster: SD07723p; n=5; Diptera|Rep: SD07723p - ... 38 0.17 UniRef50_Q23J98 Cluster: Von Willebrand factor type A domain con... 38 0.17 UniRef50_A7LBJ7 Cluster: Voltage-gated calcium channel alpha2-de... 38 0.17 UniRef50_A2E0T6 Cluster: von Willebrand factor type A domain con... 38 0.17 UniRef50_A6QUR7 Cluster: Predicted protein; n=2; Onygenales|Rep:... 38 0.17 UniRef50_UPI0000D5654E Cluster: PREDICTED: similar to CG12295-PB... 37 0.22 UniRef50_Q5KWL5 Cluster: Putative uncharacterized protein GK2636... 37 0.22 UniRef50_Q2BJH8 Cluster: Uncharacterized protein containing a vo... 37 0.22 UniRef50_A6FSG0 Cluster: Putative uncharacterized protein; n=1; ... 37 0.22 UniRef50_A6DK65 Cluster: Cardiolipin synthetase; n=1; Lentisphae... 37 0.22 UniRef50_Q7Z3S7 Cluster: Voltage-dependent calcium channel subun... 37 0.22 UniRef50_Q8IZS8 Cluster: Voltage-dependent calcium channel subun... 37 0.22 UniRef50_UPI00015B5332 Cluster: PREDICTED: similar to ENSANGP000... 37 0.29 UniRef50_A7C4W6 Cluster: von Willebrand factor, type A; n=1; Beg... 37 0.29 UniRef50_A5UX14 Cluster: von Willebrand factor, type A precursor... 37 0.29 UniRef50_A7RV93 Cluster: Predicted protein; n=2; Nematostella ve... 37 0.29 UniRef50_A2E6Y7 Cluster: von Willebrand factor type A domain con... 37 0.29 UniRef50_Q4X0P4 Cluster: Von Willebrand domain protein; n=3; Tri... 37 0.29 UniRef50_Q55874 Cluster: Uncharacterized protein sll0103; n=6; C... 37 0.29 UniRef50_UPI0000F1F488 Cluster: PREDICTED: similar to voltage-ga... 36 0.39 UniRef50_UPI00006CC819 Cluster: von Willebrand factor type A dom... 36 0.39 UniRef50_UPI000065EB99 Cluster: voltage-gated calcium channel al... 36 0.39 UniRef50_Q6LP90 Cluster: Putative uncharacterized protein; n=3; ... 36 0.39 UniRef50_Q1DFU7 Cluster: Von Willebrand factor type A domain pro... 36 0.39 UniRef50_A1VI76 Cluster: Vault protein inter-alpha-trypsin domai... 36 0.39 UniRef50_A2DPQ9 Cluster: von Willebrand factor type A domain con... 36 0.39 UniRef50_UPI00006CF2E6 Cluster: hypothetical protein TTHERM_0005... 36 0.51 UniRef50_Q4RW93 Cluster: Chromosome 9 SCAF14991, whole genome sh... 36 0.51 UniRef50_Q7UNM0 Cluster: Putative uncharacterized protein; n=1; ... 36 0.51 UniRef50_Q0LNA4 Cluster: Von Willebrand factor, type A; n=1; Her... 36 0.51 UniRef50_Q093T2 Cluster: Von Willebrand factor type A domain pro... 36 0.51 UniRef50_A6GC99 Cluster: Putative uncharacterized protein; n=1; ... 36 0.51 UniRef50_A5UUC9 Cluster: von Willebrand factor, type A; n=5; Chl... 36 0.51 UniRef50_A0V8E6 Cluster: Von Willebrand factor, type A; n=1; Del... 36 0.51 UniRef50_A0PRV7 Cluster: Conserved membrane protein; n=1; Mycoba... 36 0.51 UniRef50_A0LHW4 Cluster: Vault protein inter-alpha-trypsin domai... 36 0.51 UniRef50_A7EVE2 Cluster: Putative uncharacterized protein; n=1; ... 36 0.51 UniRef50_Q4J9H3 Cluster: Conserved protein; n=4; Sulfolobaceae|R... 36 0.51 UniRef50_Q4RXK6 Cluster: Chromosome 11 SCAF14979, whole genome s... 36 0.68 UniRef50_Q8E999 Cluster: Von Willebrand factor type A domain pro... 36 0.68 UniRef50_Q1CVN5 Cluster: Von Willebrand factor type A domain pro... 36 0.68 UniRef50_A3ZR58 Cluster: Putative uncharacterized protein; n=1; ... 36 0.68 UniRef50_A3Q9N7 Cluster: Putative outer membrane adhesin like pr... 36 0.68 UniRef50_Q9U7P4 Cluster: Putative uncharacterized protein; n=1; ... 36 0.68 UniRef50_Q22ST4 Cluster: Von Willebrand factor type A domain con... 36 0.68 UniRef50_UPI0000DC2245 Cluster: integrin, alpha D; n=4; Eutheria... 35 0.90 UniRef50_Q8D5V0 Cluster: Uncharacterized protein containing a vo... 35 0.90 UniRef50_A6M139 Cluster: von Willebrand factor, type A precursor... 35 0.90 UniRef50_A2E4Q6 Cluster: Putative uncharacterized protein; n=1; ... 35 0.90 UniRef50_Q8TYU9 Cluster: Mg-chelatase subunit ChlI and Chld; n=1... 35 0.90 UniRef50_A4YGI9 Cluster: Von Willebrand factor, type A; n=1; Met... 35 0.90 UniRef50_UPI00006CBAAA Cluster: hypothetical protein TTHERM_0050... 35 1.2 UniRef50_A5UXM2 Cluster: von Willebrand factor, type A; n=1; Ros... 35 1.2 UniRef50_A1VWQ7 Cluster: Von Willebrand factor, type A; n=3; Pro... 35 1.2 UniRef50_Q555M1 Cluster: Putative uncharacterized protein; n=2; ... 35 1.2 UniRef50_A0C946 Cluster: Chromosome undetermined scaffold_16, wh... 35 1.2 UniRef50_Q2FNC6 Cluster: Von Willebrand factor, type A; n=1; Met... 35 1.2 UniRef50_UPI0000E488A7 Cluster: PREDICTED: similar to Clca1 prot... 34 1.6 UniRef50_A6GDG5 Cluster: Putative lipoprotein; n=1; Plesiocystis... 34 1.6 UniRef50_Q25AL0 Cluster: H0102C09.6 protein; n=6; Oryza sativa|R... 34 1.6 UniRef50_Q9VJM0 Cluster: CG12455-PA, isoform A; n=4; Sophophora|... 34 1.6 UniRef50_Q54CQ8 Cluster: Putative uncharacterized protein; n=1; ... 34 1.6 UniRef50_A2E1S5 Cluster: von Willebrand factor type A domain con... 34 1.6 UniRef50_Q11GJ8 Cluster: Putative uncharacterized protein precur... 34 2.1 UniRef50_Q021L5 Cluster: Von Willebrand factor, type A precursor... 34 2.1 UniRef50_A7KFS5 Cluster: TerY1; n=6; root|Rep: TerY1 - Klebsiell... 34 2.1 UniRef50_A6GBY0 Cluster: Putative uncharacterized protein; n=1; ... 34 2.1 UniRef50_A6FSF9 Cluster: Putative uncharacterized protein; n=1; ... 34 2.1 UniRef50_A3I4T6 Cluster: Putative uncharacterized protein; n=1; ... 34 2.1 UniRef50_Q54DV3 Cluster: Putative uncharacterized protein; n=1; ... 34 2.1 UniRef50_Q9NY47 Cluster: Voltage-dependent calcium channel subun... 34 2.1 UniRef50_UPI0000499288 Cluster: conserved hypothetical protein; ... 33 2.7 UniRef50_UPI000023E141 Cluster: hypothetical protein FG02816.1; ... 33 2.7 UniRef50_A0VIA9 Cluster: Von Willebrand factor, type A precursor... 33 2.7 UniRef50_Q8LQ58 Cluster: Zinc finger (C3HC4-type RING finger)-li... 33 2.7 UniRef50_A0CCS0 Cluster: Chromosome undetermined scaffold_168, w... 33 2.7 UniRef50_Q7WHE1 Cluster: Putative exported protein; n=2; Bordete... 33 3.6 UniRef50_Q1DCJ2 Cluster: Putative uncharacterized protein; n=2; ... 33 3.6 UniRef50_A5P2L4 Cluster: von Willebrand factor, type A; n=3; Pro... 33 3.6 UniRef50_A0MNC5 Cluster: Putative uncharacterized protein; n=1; ... 33 3.6 UniRef50_Q8IB60 Cluster: Transport protein; n=9; Plasmodium|Rep:... 33 3.6 UniRef50_A7RPC2 Cluster: Predicted protein; n=1; Nematostella ve... 33 3.6 UniRef50_A7RFL6 Cluster: Predicted protein; n=1; Nematostella ve... 33 3.6 UniRef50_A2DWC0 Cluster: von Willebrand factor type A domain con... 33 3.6 UniRef50_Q13349 Cluster: Integrin alpha-D precursor; n=21; Mamma... 33 3.6 UniRef50_UPI0000ECA631 Cluster: CDK5 regulatory subunit-associat... 33 4.8 UniRef50_Q8DA69 Cluster: Putative uncharacterized protein; n=2; ... 33 4.8 UniRef50_A5G649 Cluster: UDP-3-O-(3-hydroxymyristoyl) glucosamin... 33 4.8 UniRef50_A0NVX5 Cluster: Putative uncharacterized protein; n=1; ... 33 4.8 UniRef50_A7SCF0 Cluster: Predicted protein; n=2; Eumetazoa|Rep: ... 33 4.8 UniRef50_A7S951 Cluster: Predicted protein; n=1; Nematostella ve... 33 4.8 UniRef50_A6NIY6 Cluster: Uncharacterized protein MAN1B1; n=2; Ho... 33 4.8 UniRef50_UPI000069E6F8 Cluster: dachsous 2 isoform 1; n=1; Xenop... 32 6.3 UniRef50_Q67LZ3 Cluster: Putative uncharacterized protein; n=1; ... 32 6.3 UniRef50_A6CIG8 Cluster: Putative uncharacterized protein; n=1; ... 32 6.3 UniRef50_A0C9G5 Cluster: Chromosome undetermined scaffold_16, wh... 32 6.3 UniRef50_A0MEB5 Cluster: Cyclin-A3-3; n=5; rosids|Rep: Cyclin-A3... 32 6.3 UniRef50_Q4RTV2 Cluster: Chromosome 12 SCAF14996, whole genome s... 32 8.3 UniRef50_Q3DYV9 Cluster: Von Willebrand factor, type A; n=2; Chl... 32 8.3 UniRef50_Q2B7C3 Cluster: Putative uncharacterized protein; n=1; ... 32 8.3 UniRef50_Q1D6F9 Cluster: Von Willebrand factor type A domain pro... 32 8.3 UniRef50_A6G9E8 Cluster: von Willebrand factor type A domain pro... 32 8.3 UniRef50_A3DLZ3 Cluster: Von Willebrand factor, type A; n=1; Sta... 32 8.3 UniRef50_Q9ZGE6 Cluster: Magnesium-chelatase 67 kDa subunit; n=1... 32 8.3 >UniRef50_UPI0000D560E4 Cluster: PREDICTED: similar to Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (P...; n=4; Tribolium castaneum|Rep: PREDICTED: similar to Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (P... - Tribolium castaneum Length = 842 Score = 148 bits (359), Expect = 6e-35 Identities = 78/167 (46%), Positives = 107/167 (64%), Gaps = 2/167 (1%) Frame = +1 Query: 1 VHIKETANISELRVPEIRTGNEVDATKDDAQMSNVIIQREGTSAVITFSPDLEEQKRLMH 180 VHI E+ + ++ P +RTGNE+ D I Q TSA + F+P++E QK+L Sbjct: 198 VHIDESRPLKFVKSPPLRTGNEISKNDDKTASLAEIKQNNSTSATVKFNPNIERQKQLA- 256 Query: 181 VYAEKSKESATGENAGEGVLGQFVVQYDVDR-PKDGQILVNDGYFVHFFAP-DLPPLNKY 354 + G G+ GQFVVQYDV+R PK G++L+ DGYFVHFFAP ++ L K Sbjct: 257 --------TGLGTKEENGLAGQFVVQYDVERDPKGGEVLLKDGYFVHFFAPSEVEALPKQ 308 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 V+FVLDTSGSM G +++QLKEAM +IL+EL D F+I++F SI+ V Sbjct: 309 VIFVLDTSGSMDGNRIKQLKEAMNSILSELKKEDVFNIVEFSSIVKV 355 >UniRef50_UPI0000D56533 Cluster: PREDICTED: similar to Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (P...; n=5; Tribolium castaneum|Rep: PREDICTED: similar to Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (P... - Tribolium castaneum Length = 698 Score = 141 bits (342), Expect = 7e-33 Identities = 77/167 (46%), Positives = 102/167 (61%), Gaps = 2/167 (1%) Frame = +1 Query: 1 VHIKETANISELRVPEIRTGNEVDATKDDAQMSNVIIQREGTSAVITFSPDLEEQKRLMH 180 V I ET ++ ++ P +RTGNE+ K + SA + F+PD E+QK+ Sbjct: 152 VKIDETRPLTFVKTPSLRTGNEISDDKPELDPCAKTEMINANSAKVRFNPDKEQQKKYAE 211 Query: 181 VYAEKSKESATGENAGEGVLGQFVVQYDVDR-PKDGQILVNDGYFVHFFAPD-LPPLNKY 354 + K +G+ GQFVVQYDV+R PK G++L+ DGYFVHFFAP L K+ Sbjct: 212 LLGSKD----------QGLAGQFVVQYDVERDPKGGEVLLRDGYFVHFFAPSGLQTFPKH 261 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 VVFVLD SGSM GRK EQLK+AM IL++LNP D F I+ F I++V Sbjct: 262 VVFVLDHSGSMGGRKYEQLKQAMDKILSDLNPDDLFHIVRFSEIVSV 308 >UniRef50_UPI0000D560E0 Cluster: PREDICTED: similar to Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (P...; n=1; Tribolium castaneum|Rep: PREDICTED: similar to Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (P... - Tribolium castaneum Length = 815 Score = 111 bits (268), Expect = 6e-24 Identities = 65/161 (40%), Positives = 93/161 (57%), Gaps = 2/161 (1%) Frame = +1 Query: 1 VHIKETANISELRVPEIRTGNEVDATKDDAQMSNVIIQREGTSAVITFSPDLEEQKRLMH 180 +HI E+ + + P +RTGNE+ D S + Q E T A + F P+ Q ++ Sbjct: 189 IHINESRPLKFVNTPFLRTGNEIGNNDDKVYFSGKM-QVESTLAFMEFKPEKSRQSQIGQ 247 Query: 181 VYAEKSKESATGENAGEGVLGQFVVQYDVDRPKDG-QILVNDGYFVHFFAPD-LPPLNKY 354 + +K G+ GQ VV+YDV+R G +ILV++GYFVHFF+P L PL K+ Sbjct: 248 LLGNGNKT---------GIAGQLVVEYDVERDSHGGEILVHNGYFVHFFSPSGLKPLPKH 298 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 VVFVL+ +M GRK++QL +AM IL+EL D F I+ F Sbjct: 299 VVFVLNHGLTMHGRKIDQLIDAMQKILSELTENDAFDIVRF 339 >UniRef50_Q5T665 Cluster: Inter-alpha inhibitor H5; n=34; Tetrapoda|Rep: Inter-alpha inhibitor H5 - Homo sapiens (Human) Length = 956 Score = 110 bits (265), Expect = 1e-23 Identities = 69/170 (40%), Positives = 98/170 (57%), Gaps = 5/170 (2%) Frame = +1 Query: 1 VHIKETANISELRVPEIRTGNEVDATK---DDAQMSNVIIQREGTSAVITFSPDLEEQKR 171 V+I E+A I+ L V + + + + D + +I + T A I F P + +Q R Sbjct: 189 VNILESAGIASLEVLPLHNSRQRGSGRGEDDSGPPPSTVINQNETFANIIFKPTVVQQAR 248 Query: 172 LMHVYAEKSKESATGENAGEGVLGQFVVQYDVDRPKD-GQILVNDGYFVHFFAP-DLPPL 345 + A G+LG F+++YDV+R + G I V +GYFVH+FAP DLPPL Sbjct: 249 I----------------AQNGILGDFIIRYDVNREQSIGDIQVLNGYFVHYFAPKDLPPL 292 Query: 346 NKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 K VVFVLD+S SM G K+ Q K+A++TIL++L P D FSII F + I V Sbjct: 293 PKNVVFVLDSSASMVGTKLRQTKDALFTILHDLRPQDRFSIIGFSNRIKV 342 >UniRef50_Q5RHF3 Cluster: Novel protein similar to vertebrate inter-alpha (Globulin) inhibitor H5; n=5; Danio rerio|Rep: Novel protein similar to vertebrate inter-alpha (Globulin) inhibitor H5 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 906 Score = 109 bits (261), Expect = 5e-23 Identities = 71/172 (41%), Positives = 101/172 (58%), Gaps = 7/172 (4%) Frame = +1 Query: 1 VHIKETANISELRVPEIRTGNEVDAT---KDDA--QMSNVIIQREGTSAVITFSPDLEEQ 165 V I E + IS L V ++ G + + K DA +S ++ Q E T I+F+P++ +Q Sbjct: 146 VTIVEHSRISYLEVLPLQNGKKTSSNGNGKADAGPPVSTIVKQNE-TFCKISFTPNIAQQ 204 Query: 166 KRLMHVYAEKSKESATGENAGEGVLGQFVVQYDVDRPKD-GQILVNDGYFVHFFAP-DLP 339 ++ A G+LG+FVV YDV+R G I V DG+FVH+FAP DLP Sbjct: 205 AKI----------------ATNGMLGEFVVHYDVERETGIGDIQVQDGHFVHYFAPRDLP 248 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 + K VVFV+DTS SM G KM+Q K+A++TI+NEL P D F+ + F + I V Sbjct: 249 VVPKNVVFVIDTSASMLGTKMKQTKQALFTIINELRPNDNFNFVTFSNRIRV 300 >UniRef50_UPI000065DA1D Cluster: Homolog of Homo sapiens "Inter-alpha (globulIn) InhIbItor H3; n=1; Takifugu rubripes|Rep: Homolog of Homo sapiens "Inter-alpha (globulIn) InhIbItor H3 - Takifugu rubripes Length = 748 Score = 104 bits (249), Expect = 1e-21 Identities = 59/127 (46%), Positives = 82/127 (64%), Gaps = 2/127 (1%) Frame = +1 Query: 115 REGTSAVITFSPDLEEQKRLMHVYAEKSKESATGENAGEGVLGQFVVQYDVDRPKD-GQI 291 R T A I+FSP +E+Q++ + G + G F+++YDV+R K+ G I Sbjct: 135 RSHTQAHISFSPTIEQQRKCP-------------DCPGTIIDGDFIIKYDVNRDKNLGDI 181 Query: 292 LVNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSI 468 + +GYFVHFFAP DL L K VVFV+D SGSMSG KM+Q++EAM IL +L+P D+F I Sbjct: 182 QIANGYFVHFFAPKDLTRLPKNVVFVIDRSGSMSGTKMQQIQEAMIKILEDLHPEDHFGI 241 Query: 469 IDFESII 489 I F+S + Sbjct: 242 IQFDSSV 248 >UniRef50_UPI000155CC23 Cluster: PREDICTED: similar to ITI-like protein; n=3; Amniota|Rep: PREDICTED: similar to ITI-like protein - Ornithorhynchus anatinus Length = 1374 Score = 103 bits (247), Expect = 2e-21 Identities = 50/94 (53%), Positives = 68/94 (72%), Gaps = 3/94 (3%) Frame = +1 Query: 223 AGEGVLGQFVVQYDVDRPKD--GQILVNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSG 393 + G++G FVVQYDV KD G + + +GYFVH+FAP LPP+ K VVFV+D SGSM G Sbjct: 274 SSSGIMGDFVVQYDVSM-KDIIGDVQIYNGYFVHYFAPRGLPPVQKNVVFVIDVSGSMFG 332 Query: 394 RKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 KM+Q K+AM+ ILN+L+ DYF+I+ F ++V Sbjct: 333 TKMKQTKKAMHVILNDLHHDDYFNIVTFSDAVSV 366 >UniRef50_Q6UXX5 Cluster: Inter-alpha-trypsin inhibitor heavy chain H5-like protein precursor; n=12; Euarchontoglires|Rep: Inter-alpha-trypsin inhibitor heavy chain H5-like protein precursor - Homo sapiens (Human) Length = 1313 Score = 103 bits (247), Expect = 2e-21 Identities = 65/170 (38%), Positives = 91/170 (53%), Gaps = 5/170 (2%) Frame = +1 Query: 1 VHIKETANISELRVPEIRTGN---EVDATKDDAQMSNVIIQREGTSAVITFSPDLEEQKR 171 V + E IS + +P +RTG A++ D+ S I +R T IT+ P L++Q Sbjct: 178 VTVSERTGISYVHIPPLRTGRLRTNAHASEVDSPPSTRI-ERGETCVRITYCPTLQDQSS 236 Query: 172 LMHVYAEKSKESATGENAGEGVLGQFVVQYDVDRPKD-GQILVNDGYFVHFFAP-DLPPL 345 + +G G++ F+VQYDV G + + D YF+H+FAP LPP+ Sbjct: 237 I----------------SGSGIMADFLVQYDVVMEDIIGDVQIYDDYFIHYFAPRGLPPM 280 Query: 346 NKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 K VVFV+D S SM G KMEQ K AM IL++L DYF+II F + V Sbjct: 281 EKNVVFVIDVSSSMFGTKMEQTKTAMNVILSDLQANDYFNIISFSDTVNV 330 >UniRef50_Q4SBF6 Cluster: Chromosome 11 SCAF14674, whole genome shotgun sequence; n=7; Euteleostomi|Rep: Chromosome 11 SCAF14674, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1039 Score = 102 bits (245), Expect = 4e-21 Identities = 58/123 (47%), Positives = 80/123 (65%), Gaps = 2/123 (1%) Frame = +1 Query: 118 EGTSAVITFSPDLEEQKRLMHVYAEKSKESATGENAGEGVLGQFVVQYDVDRPKD-GQIL 294 +G +A I+FSP +E+Q++ + G + G F+++YDV+R D G I Sbjct: 367 DGGTARISFSPTIEQQRKCP-------------DCPGTLIDGDFIIKYDVNRENDLGDIQ 413 Query: 295 VNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSII 471 + +GYFVHFFAP DLP L K VVFV+D SGSMSG KM+Q +EAM IL +L+P D+F II Sbjct: 414 IANGYFVHFFAPKDLPRLPKNVVFVIDMSGSMSGTKMQQTREAMLKILEDLDPEDHFGII 473 Query: 472 DFE 480 F+ Sbjct: 474 LFD 476 Score = 76.2 bits (179), Expect = 4e-13 Identities = 37/58 (63%), Positives = 45/58 (77%), Gaps = 2/58 (3%) Frame = +1 Query: 241 GQFVVQYDVDRPKD-GQILVNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKMEQ 408 G F+++YDV+R D G I + +GYFVHFFAP DLP L K VVFV+D SGSMSG KM+Q Sbjct: 295 GDFIIKYDVNRENDLGDIQIANGYFVHFFAPKDLPRLPKNVVFVIDMSGSMSGTKMQQ 352 >UniRef50_UPI0000E25D56 Cluster: PREDICTED: inter-alpha (globulin) inhibitor H5-like; n=1; Pan troglodytes|Rep: PREDICTED: inter-alpha (globulin) inhibitor H5-like - Pan troglodytes Length = 689 Score = 100 bits (240), Expect = 2e-20 Identities = 64/170 (37%), Positives = 90/170 (52%), Gaps = 5/170 (2%) Frame = +1 Query: 1 VHIKETANISELRVPEIRTGN---EVDATKDDAQMSNVIIQREGTSAVITFSPDLEEQKR 171 V + E IS + +P +RT A++ D+ S I +R T IT+ P L++Q Sbjct: 178 VTVSERTGISYVHIPPLRTSRLRTNAHASEVDSPPSTRI-ERGETCVRITYCPTLQDQSS 236 Query: 172 LMHVYAEKSKESATGENAGEGVLGQFVVQYDVDRPKD-GQILVNDGYFVHFFAP-DLPPL 345 + +G G++ F+VQYDV G + + D YF+H+FAP LPP+ Sbjct: 237 I----------------SGSGIMADFLVQYDVVMEDIIGDVQIYDDYFIHYFAPRGLPPM 280 Query: 346 NKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 K VVFV+D S SM G KMEQ K AM IL++L DYF+II F + V Sbjct: 281 EKNVVFVIDVSSSMFGTKMEQTKMAMNVILSDLQANDYFNIISFSDTVNV 330 >UniRef50_Q4SBF5 Cluster: Chromosome 11 SCAF14674, whole genome shotgun sequence; n=2; Tetraodon nigroviridis|Rep: Chromosome 11 SCAF14674, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 849 Score = 99 bits (238), Expect = 3e-20 Identities = 49/82 (59%), Positives = 62/82 (75%), Gaps = 2/82 (2%) Frame = +1 Query: 241 GQFVVQYDVDRPKD-GQILVNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKMEQLK 414 G F+++YDV+R D G I + +GYFVHFFAP DLP L K VVFV+D SGSMSG KM+Q + Sbjct: 231 GDFIIKYDVNRENDLGDIQIANGYFVHFFAPKDLPRLPKNVVFVIDMSGSMSGTKMQQTR 290 Query: 415 EAMYTILNELNPGDYFSIIDFE 480 EAM IL +L+P D+F II F+ Sbjct: 291 EAMLKILEDLDPEDHFGIILFD 312 >UniRef50_UPI000065F8E3 Cluster: inter-alpha (globulin) inhibitor H5-like; n=1; Takifugu rubripes|Rep: inter-alpha (globulin) inhibitor H5-like - Takifugu rubripes Length = 776 Score = 95.9 bits (228), Expect = 5e-19 Identities = 61/161 (37%), Positives = 92/161 (57%), Gaps = 2/161 (1%) Frame = +1 Query: 1 VHIKETANISELRVPEIRTGNEVDATKDDAQMSNVIIQREGTSAVITFSPDLEEQKRLMH 180 V I E +S ++V ++T + +T +A S + Q A + +SP L++Q + Sbjct: 144 VSITEQTGLSFVKVLPLKTSRLLSSTAQEAPASTRVEQNP-CCARVHYSPSLQQQSSV-- 200 Query: 181 VYAEKSKESATGENAGEGVLGQFVVQYDVD-RPKDGQILVNDGYFVHFFAPD-LPPLNKY 354 + +GV F++QYDV R G++ V+DGYFVH+FAP LP + K Sbjct: 201 --------------SPKGVHADFMIQYDVALRDLMGEVQVHDGYFVHYFAPKGLPVVPKD 246 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 V+FV+D SGSM G K++Q K+AM TIL +L GD+F+II F Sbjct: 247 VIFVIDVSGSMIGTKIKQTKQAMSTILADLREGDHFNIITF 287 >UniRef50_Q4S685 Cluster: Chromosome 9 SCAF14729, whole genome shotgun sequence; n=3; Clupeocephala|Rep: Chromosome 9 SCAF14729, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 608 Score = 94.7 bits (225), Expect = 1e-18 Identities = 60/163 (36%), Positives = 95/163 (58%), Gaps = 4/163 (2%) Frame = +1 Query: 1 VHIKETANISELRVPEIRTGNEV-DATKDDAQM-SNVIIQREGTSAVITFSPDLEEQKRL 174 V + E IS ++V +RT + A + DA+ ++ +++ A + +SP L++Q + Sbjct: 144 VSVTEQTGISFIKVLPLRTSRLLPSAAQADAEAPASTRVEQSACCARVYYSPTLQQQSSV 203 Query: 175 MHVYAEKSKESATGENAGEGVLGQFVVQYDVD-RPKDGQILVNDGYFVHFFAPD-LPPLN 348 + +G+ F++QYDV R G++ V+DGYFVH+FAP LP + Sbjct: 204 ----------------SSKGLHADFILQYDVALRDLLGEVQVHDGYFVHYFAPKGLPVVP 247 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 K V+FV+D SGSM G K++Q K+AM TIL +L GD+F+II F Sbjct: 248 KDVIFVIDVSGSMIGTKIQQTKQAMSTILADLREGDHFNIITF 290 >UniRef50_Q6PGW2 Cluster: Zgc:112265 protein; n=11; Clupeocephala|Rep: Zgc:112265 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 927 Score = 93.5 bits (222), Expect = 2e-18 Identities = 63/167 (37%), Positives = 95/167 (56%), Gaps = 4/167 (2%) Frame = +1 Query: 1 VHIKETANISELRVP-EIRTGNEVDATKDDAQMSNVIIQREGTSAVITFSPDLEEQKRLM 177 VHI+E IS L V ++ TG+ A K R A +TF P ++Q Sbjct: 178 VHIQENPGISFLEVKGDLNTGDLASAVKTT---------RADKDAWVTFYPTRDQQ---- 224 Query: 178 HVYAEKSKESATGENAGEGVLGQFVVQYDVDR--PKDGQILVNDGYFVHFFAP-DLPPLN 348 +K + EN G+ G ++ YDV+R PK G++ +++GYFVH+FAP D+P + Sbjct: 225 ------TKCTNCAEN---GLNGDLIITYDVNRGNPK-GEVQISNGYFVHYFAPSDVPHIP 274 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 K VVF++D SGSM GRK+ Q + A+ TIL +L+ D+F +I F++ I Sbjct: 275 KNVVFIIDRSGSMHGRKIRQTRSALLTILKDLDEDDHFGLITFDAEI 321 >UniRef50_Q503P4 Cluster: Zgc:110377; n=9; Euteleostomi|Rep: Zgc:110377 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 868 Score = 93.5 bits (222), Expect = 2e-18 Identities = 57/124 (45%), Positives = 74/124 (59%), Gaps = 2/124 (1%) Frame = +1 Query: 130 AVITFSPDLEEQKRLMHVYAEKSKESATGENAGEGVLGQFVVQYDVDRPKD-GQILVNDG 306 A ++FSP L++Q++ E G + G F + YDV+RP D G I + +G Sbjct: 193 AHVSFSPTLDQQRKCT-------------ECDGTLIDGDFFITYDVNRPHDIGDIQIVNG 239 Query: 307 YFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 YFVHFFAP +LP + K VVFV+D S SM G KM Q KEA+ TIL EL DYF+II F + Sbjct: 240 YFVHFFAPANLPRVPKMVVFVIDNSYSMYGNKMAQTKEALGTILGELPEDDYFAIIVFST 299 Query: 484 IITV 495 V Sbjct: 300 TFVV 303 >UniRef50_UPI0000E460BF Cluster: PREDICTED: similar to inter-alpha-trypsin inhibitor heavy chain3; n=5; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to inter-alpha-trypsin inhibitor heavy chain3 - Strongylocentrotus purpuratus Length = 1028 Score = 92.3 bits (219), Expect = 6e-18 Identities = 52/131 (39%), Positives = 74/131 (56%), Gaps = 2/131 (1%) Frame = +1 Query: 97 SNVIIQREGTSAVITFSPDLEEQKRLMHVYAEKSKESATGENAGEGVLGQFVVQYDVDRP 276 S +I + A + L+ + R H+ + SKE + G++G F+V YDV Sbjct: 224 STWLISDKNDQAKLNSMTTLDIKPRTAHILFD-SKEEGLLTTSRRGIMGDFIVTYDVIHT 282 Query: 277 KD-GQILVNDGYFVHFFAPD-LPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNP 450 K G + + DGYFVH+F+PD LP K V+FV+D SGSM G+K Q K A TIL+++ P Sbjct: 283 KKAGHLEIVDGYFVHYFSPDGLPNTRKNVIFVIDVSGSMYGQKTRQTKRAFTTILDDVRP 342 Query: 451 GDYFSIIDFES 483 D +II F S Sbjct: 343 IDRINIILFSS 353 >UniRef50_P19823 Cluster: Inter-alpha-trypsin inhibitor heavy chain H2 precursor; n=37; Euteleostomi|Rep: Inter-alpha-trypsin inhibitor heavy chain H2 precursor - Homo sapiens (Human) Length = 946 Score = 91.9 bits (218), Expect = 7e-18 Identities = 48/85 (56%), Positives = 61/85 (71%), Gaps = 2/85 (2%) Frame = +1 Query: 241 GQFVVQYDVDRP-KDGQILVNDGYFVHFFAPD-LPPLNKYVVFVLDTSGSMSGRKMEQLK 414 G+ VV YDV R K G++ V +GYFVHFFAPD L P+ K ++FV+D SGSM G KM+Q Sbjct: 271 GELVVLYDVKREEKAGELEVFNGYFVHFFAPDNLDPIPKNILFVIDVSGSMWGVKMKQTV 330 Query: 415 EAMYTILNELNPGDYFSIIDFESII 489 EAM TIL++L D+FS+IDF I Sbjct: 331 EAMKTILDDLRAEDHFSVIDFNQNI 355 >UniRef50_UPI0000D8C94A Cluster: Novel protein similar to vertebrate inter-alpha (Globulin) inhibitor H family (Plasma Kallikrein-sensitive glycoprotein) (ITIH); n=1; Danio rerio|Rep: Novel protein similar to vertebrate inter-alpha (Globulin) inhibitor H family (Plasma Kallikrein-sensitive glycoprotein) (ITIH) - Danio rerio Length = 745 Score = 91.5 bits (217), Expect = 1e-17 Identities = 44/85 (51%), Positives = 62/85 (72%), Gaps = 2/85 (2%) Frame = +1 Query: 229 EGVLGQFVVQYDVD-RPKDGQILVNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKM 402 +G+ F++QYDV+ + G I V+DGYFVH+FAP LP + K V+FV+D SGSM G K+ Sbjct: 134 KGLSADFIIQYDVELKDPMGDIQVDDGYFVHYFAPRGLPVVPKDVIFVIDISGSMIGTKI 193 Query: 403 EQLKEAMYTILNELNPGDYFSIIDF 477 +Q K AM +IL++L GDYF++I F Sbjct: 194 KQTKAAMVSILSDLREGDYFNLITF 218 >UniRef50_Q14624 Cluster: Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (PK-120) (GP120) [Contains: 70 kDa inter-alpha-trypsin inhibitor heavy chain H4; 35 kDa inter-alpha- trypsin inhibitor heavy chain H4]; n=27; Eutheria|Rep: Inter-alpha-trypsin inhibitor heavy chain H4 precursor (ITI heavy chain H4) (Inter-alpha-inhibitor heavy chain 4) (Inter-alpha-trypsin inhibitor family heavy chain-related protein) (IHRP) (Plasma kallikrein sensitive glycoprotein 120) (PK-120) (GP120) [Contains: 70 kDa inter-alpha-trypsin inhibitor heavy chain H4; 35 kDa inter-alpha- trypsin inhibitor heavy chain H4] - Homo sapiens (Human) Length = 930 Score = 89.8 bits (213), Expect = 3e-17 Identities = 43/86 (50%), Positives = 62/86 (72%), Gaps = 2/86 (2%) Frame = +1 Query: 241 GQFVVQYDVDRP-KDGQILVNDGYFVHFFAPD-LPPLNKYVVFVLDTSGSMSGRKMEQLK 414 G +++YDVDR G I + +GYFVH+FAP+ L + K VVFV+D SGSMSGRK++Q + Sbjct: 235 GNLIIRYDVDRAISGGSIQIENGYFVHYFAPEGLTTMPKNVVFVIDKSGSMSGRKIQQTR 294 Query: 415 EAMYTILNELNPGDYFSIIDFESIIT 492 EA+ IL++L+P D F++I F + T Sbjct: 295 EALIKILDDLSPRDQFNLIVFSTEAT 320 >UniRef50_UPI0000E47594 Cluster: PREDICTED: similar to inter-alpha (globulin) inhibitor H3 variant; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to inter-alpha (globulin) inhibitor H3 variant - Strongylocentrotus purpuratus Length = 902 Score = 89.0 bits (211), Expect = 5e-17 Identities = 47/108 (43%), Positives = 69/108 (63%), Gaps = 2/108 (1%) Frame = +1 Query: 160 EQKRLMHVYAEKSKESATGENAGEGVLGQFVVQYDVDRPKDGQ-ILVNDGYFVHFFAPD- 333 + +R +YA +E T N G +G + VQYD + P+DG I + D +FV FF+P Sbjct: 282 KDERWEMIYAPGPREQ-TAANPN-GFMGDYTVQYDTNNPEDGSDIQILDNHFVQFFSPSG 339 Query: 334 LPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 LP L K V+F++D SGSM+G K+ Q+K+A+ TILN++ D F+II F Sbjct: 340 LPVLRKNVIFIIDVSGSMAGVKLRQVKDALTTILNDMPETDKFNIIPF 387 >UniRef50_UPI0000E1FD23 Cluster: PREDICTED: inter-alpha (globulin) inhibitor H3 isoform 2; n=6; Amniota|Rep: PREDICTED: inter-alpha (globulin) inhibitor H3 isoform 2 - Pan troglodytes Length = 865 Score = 88.2 bits (209), Expect = 9e-17 Identities = 41/85 (48%), Positives = 56/85 (65%), Gaps = 1/85 (1%) Frame = +1 Query: 241 GQFVVQYDVDRPKDGQILVNDGYFVHFFAPD-LPPLNKYVVFVLDTSGSMSGRKMEQLKE 417 G F + YDV+R G + + +GYFVHFFAP LP + K V FV+D SGSM+GRK+EQ KE Sbjct: 221 GDFTITYDVNRESPGNVQIVNGYFVHFFAPQGLPVVPKNVAFVIDISGSMAGRKLEQTKE 280 Query: 418 AMYTILNELNPGDYFSIIDFESIIT 492 A+ IL ++ DY + I F ++ Sbjct: 281 ALLRILEDMKEEDYLNFILFSGDVS 305 >UniRef50_P19827 Cluster: Inter-alpha-trypsin inhibitor heavy chain H1 precursor; n=58; Mammalia|Rep: Inter-alpha-trypsin inhibitor heavy chain H1 precursor - Homo sapiens (Human) Length = 911 Score = 88.2 bits (209), Expect = 9e-17 Identities = 42/80 (52%), Positives = 56/80 (70%), Gaps = 1/80 (1%) Frame = +1 Query: 241 GQFVVQYDVDRPKDGQILVNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKMEQLKE 417 G F V YDV R K +LV + +F HFFAP +L +NK VVFV+D SGSM G+K++Q KE Sbjct: 254 GHFKVTYDVSRDKICDLLVANNHFAHFFAPQNLTNMNKNVVFVIDISGSMRGQKVKQTKE 313 Query: 418 AMYTILNELNPGDYFSIIDF 477 A+ IL ++ PGDYF ++ F Sbjct: 314 ALLKILGDMQPGDYFDLVLF 333 >UniRef50_UPI0000F2DDBB Cluster: PREDICTED: similar to Inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein); n=1; Monodelphis domestica|Rep: PREDICTED: similar to Inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein) - Monodelphis domestica Length = 819 Score = 87.8 bits (208), Expect = 1e-16 Identities = 42/86 (48%), Positives = 62/86 (72%), Gaps = 2/86 (2%) Frame = +1 Query: 241 GQFVVQYDVDRPKD-GQILVNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKMEQLK 414 G+F+V+YDVDR G I + +GYFVH FAP LP + K +VF++D SGSM+GRK+++ K Sbjct: 223 GKFIVRYDVDRVTTAGDIQIENGYFVHNFAPTQLPMVPKNIVFLIDKSGSMAGRKIKKTK 282 Query: 415 EAMYTILNELNPGDYFSIIDFESIIT 492 A+ IL++L P D+F++I F +T Sbjct: 283 AALIKILDDLKPEDHFNMITFSGHVT 308 >UniRef50_Q498Q0 Cluster: Zgc:113924; n=5; Danio rerio|Rep: Zgc:113924 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 892 Score = 87.4 bits (207), Expect = 2e-16 Identities = 45/104 (43%), Positives = 63/104 (60%), Gaps = 2/104 (1%) Frame = +1 Query: 184 YAEKSKESATGENAGEGVLGQFVVQYDVDRPKD-GQILVNDGYFVHFFAP-DLPPLNKYV 357 Y + ++ + G+ G V+ YDV+R K G V +GYFVH+FAP D+ + K V Sbjct: 210 YPTRDQQKDCDDCTKNGLNGNLVIMYDVERVKQSGDFKVANGYFVHYFAPTDVQRIPKNV 269 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 VF++D SGSM G K+EQ + AM IL++L DYF +I F S I Sbjct: 270 VFIIDQSGSMQGNKIEQTRMAMLRILSDLAKDDYFGLITFSSHI 313 >UniRef50_P79263 Cluster: Inter-alpha-trypsin inhibitor heavy chain H4 precursor; n=7; Euteleostomi|Rep: Inter-alpha-trypsin inhibitor heavy chain H4 precursor - Sus scrofa (Pig) Length = 921 Score = 86.2 bits (204), Expect = 4e-16 Identities = 53/126 (42%), Positives = 75/126 (59%), Gaps = 3/126 (2%) Frame = +1 Query: 109 IQREGTSAVITFSPDLEEQKRLMHVYAEKSKESATGENAGEGVL-GQFVVQYDVDRP-KD 282 I + T A I F P L +Q +KS E E VL G F+V+YDV+R Sbjct: 202 ISQNKTKAHIRFKPTLSQQ--------QKSPEQQ------ETVLDGNFIVRYDVNRTVTG 247 Query: 283 GQILVNDGYFVHFFAPDL-PPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDY 459 G I + +GYFVH+FAP++ + K V+FV+DTSGSM GRK++Q +EA+ IL +L D Sbjct: 248 GSIQIENGYFVHYFAPEVWSAIPKNVIFVIDTSGSMRGRKIQQTREALIKILGDLGSRDQ 307 Query: 460 FSIIDF 477 F+++ F Sbjct: 308 FNLVSF 313 >UniRef50_UPI00005843FB Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 429 Score = 81.8 bits (193), Expect = 8e-15 Identities = 43/116 (37%), Positives = 65/116 (56%), Gaps = 2/116 (1%) Frame = +1 Query: 136 ITFSPDLEEQKRLMHVYAEKSKESATGENAGEGVLGQFVVQYDV-DRPKDGQILVNDGYF 312 + S DL + + + + + +G+ G V+ Y++ D P V + YF Sbjct: 90 VDLSRDLVRESNSRYKFRYMPTPDEQSDFSEKGIDGDVVLTYNLMDAPTGSHTQVQNDYF 149 Query: 313 VHFFAP-DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 VHFF+P L ++K +VFV+D S SM G K+ Q KEA+ T+L+ LNP DYF+II F Sbjct: 150 VHFFSPIGLDVISKQIVFVIDVSASMYGTKLSQTKEALKTMLDNLNPTDYFNIITF 205 >UniRef50_UPI0000E46E0F Cluster: PREDICTED: similar to LOC594926 protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to LOC594926 protein - Strongylocentrotus purpuratus Length = 870 Score = 80.6 bits (190), Expect = 2e-14 Identities = 39/88 (44%), Positives = 57/88 (64%), Gaps = 2/88 (2%) Frame = +1 Query: 232 GVLGQFVVQYDVDRPKD-GQILVNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKME 405 G+ G F+++YDV P G++ + F+H FAP + + K VVFVLD S SM G K++ Sbjct: 286 GINGDFIIRYDVAHPPGVGEVQTSGTNFIHRFAPANFGAVKKRVVFVLDFSASMYGNKIK 345 Query: 406 QLKEAMYTILNELNPGDYFSIIDFESII 489 Q KEAMYTIL+E+N D F+++ F + Sbjct: 346 QTKEAMYTILDEMNDSDRFNVLPFSDYV 373 >UniRef50_UPI00006A1915 Cluster: Transmembrane protein 110.; n=4; Xenopus tropicalis|Rep: Transmembrane protein 110. - Xenopus tropicalis Length = 728 Score = 77.0 bits (181), Expect = 2e-13 Identities = 51/134 (38%), Positives = 77/134 (57%), Gaps = 4/134 (2%) Frame = +1 Query: 91 QMSNVI-IQREGTSAVITFSPDLEEQKRLMHVYAEKSKESATGENAGEGVL-GQFVVQYD 264 ++++V+ I R A ITF P +++Q+ T E +L G F+++YD Sbjct: 172 ELTDVVHINRTENQAQITFKPTMDQQR--------------TCPECTETLLDGDFLIKYD 217 Query: 265 VDRPK-DGQILVNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILN 438 V R G I +++GYFVH+FAP L + K VVFV+D SGSM G+K++Q EA IL Sbjct: 218 VKRENVAGNIQISNGYFVHYFAPASLQKVPKNVVFVIDHSGSMHGQKIKQTYEAFLKILA 277 Query: 439 ELNPGDYFSIIDFE 480 +L D+F I+ F+ Sbjct: 278 DLPEEDHFGILIFD 291 >UniRef50_UPI000058940A Cluster: PREDICTED: similar to inter-alpha (globulin) inhibitor H3; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to inter-alpha (globulin) inhibitor H3 - Strongylocentrotus purpuratus Length = 964 Score = 75.8 bits (178), Expect = 5e-13 Identities = 37/84 (44%), Positives = 57/84 (67%), Gaps = 2/84 (2%) Frame = +1 Query: 232 GVLGQFVVQYDVDRPKD-GQILVNDGYFVHFFAPD-LPPLNKYVVFVLDTSGSMSGRKME 405 G++ + V+YDV D G I V + YFV +F+P L L K ++FV+D SGSMSG K+ Sbjct: 308 GIMADYTVRYDVVHGNDAGDIQVLNDYFVQYFSPSGLSVLRKNIIFVIDISGSMSGTKLA 367 Query: 406 QLKEAMYTILNELNPGDYFSIIDF 477 Q+K+A+ TIL++++ D F+I+ F Sbjct: 368 QVKDALSTILDDMSETDKFNILPF 391 >UniRef50_UPI000065D60D Cluster: inter-alpha trypsin inhibitor heavy chain precursor 5 isoform 1; n=1; Takifugu rubripes|Rep: inter-alpha trypsin inhibitor heavy chain precursor 5 isoform 1 - Takifugu rubripes Length = 1071 Score = 73.3 bits (172), Expect = 3e-12 Identities = 45/104 (43%), Positives = 63/104 (60%), Gaps = 2/104 (1%) Frame = +1 Query: 109 IQREGTSAVITFSPDLEEQKRLMHVYAEKSKESATGENAGEGVLGQFVVQYDVDRPKD-G 285 I++E ITFSP++ +Q R+ A G+LG FV++YDV R G Sbjct: 195 IKKEKNMCRITFSPNIVQQARI----------------ATNGLLGDFVIRYDVQRDLGIG 238 Query: 286 QILVNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKMEQLK 414 I V +G+FVH+FAP DLP + K VVFV+DTS SM G+K+ Q++ Sbjct: 239 DIQVLNGHFVHYFAPKDLPAVPKNVVFVIDTSASMLGKKIRQVR 282 Score = 39.5 bits (88), Expect = 0.042 Identities = 16/32 (50%), Positives = 23/32 (71%) Frame = +1 Query: 400 MEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 + Q KEA++TIL +L PGD+F+ I F S + V Sbjct: 430 VHQTKEALFTILGDLRPGDHFNFISFSSRVKV 461 >UniRef50_UPI0000EB3907 Cluster: Transmembrane protein 110.; n=3; Mammalia|Rep: Transmembrane protein 110. - Canis familiaris Length = 581 Score = 72.1 bits (169), Expect = 6e-12 Identities = 33/59 (55%), Positives = 46/59 (77%), Gaps = 2/59 (3%) Frame = +1 Query: 241 GQFVVQYDVDRP-KDGQILVNDGYFVHFFAPD-LPPLNKYVVFVLDTSGSMSGRKMEQL 411 G F+V+YDV+R G I + +GYFVH+FAP+ LP + K V+FV+D SGSMSGRK++Q+ Sbjct: 147 GNFIVRYDVNRTLSGGSIQIENGYFVHYFAPEGLPTIPKNVIFVIDKSGSMSGRKIQQV 205 >UniRef50_A3ZZ07 Cluster: Inter-alpha-trypsin inhibitor family heavy chain-related protein- hypothetical secreted or membrane-associated; n=1; Blastopirellula marina DSM 3645|Rep: Inter-alpha-trypsin inhibitor family heavy chain-related protein- hypothetical secreted or membrane-associated - Blastopirellula marina DSM 3645 Length = 788 Score = 62.1 bits (144), Expect = 7e-09 Identities = 33/72 (45%), Positives = 45/72 (62%), Gaps = 5/72 (6%) Frame = +1 Query: 301 DGYFVHFFAPDLPPLN-----KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFS 465 DGYF+ +P + + K V+FV+D SGSMSG K+EQ KEA +LN LN GD F+ Sbjct: 273 DGYFLLLASPPVEEVGDVKTKKTVIFVVDRSGSMSGEKIEQAKEAAKFVLNNLNEGDLFN 332 Query: 466 IIDFESIITVHE 501 II ++S + E Sbjct: 333 IIAYDSDVESFE 344 >UniRef50_Q60ED8 Cluster: Von Willebrand factor type A domain containing protein; n=9; Oryza sativa|Rep: Von Willebrand factor type A domain containing protein - Oryza sativa subsp. japonica (Rice) Length = 801 Score = 58.0 bits (134), Expect = 1e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 VF++DTSGSM G+ +E +K AMYT L+EL GDYF+II F Sbjct: 335 VFIIDTSGSMQGKPLESVKNAMYTTLSELVQGDYFNIITF 374 >UniRef50_A3AIY9 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 768 Score = 58.0 bits (134), Expect = 1e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 VF++DTSGSM G+ +E +K AMYT L+EL GDYF+II F Sbjct: 302 VFIIDTSGSMQGKPLESVKNAMYTTLSELVQGDYFNIITF 341 >UniRef50_Q4S5G0 Cluster: Chromosome 19 SCAF14731, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 19 SCAF14731, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 993 Score = 55.6 bits (128), Expect = 6e-07 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +1 Query: 295 VNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKMEQLK 414 V DG+FVH+FAP DLP + K VVFV+DTS SM G+KM Q++ Sbjct: 239 VLDGHFVHYFAPKDLPAVPKNVVFVIDTSASMLGKKMRQVR 279 Score = 33.9 bits (74), Expect = 2.1 Identities = 20/42 (47%), Positives = 23/42 (54%) Frame = +1 Query: 370 DTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 D G GRK KEA+ TIL +L P D F+ I F S I V Sbjct: 317 DYFGPPCGRKT---KEALLTILGDLRPADRFNFISFSSRIRV 355 >UniRef50_UPI0000D9F467 Cluster: PREDICTED: trophinin; n=2; Catarrhini|Rep: PREDICTED: trophinin - Macaca mulatta Length = 1648 Score = 54.4 bits (125), Expect = 1e-06 Identities = 24/41 (58%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = +1 Query: 289 ILVNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKMEQ 408 + + DGYF+H+FAP LPP +K VVFV+D SG M G KM+Q Sbjct: 8 VQIYDGYFIHYFAPRGLPPTDKNVVFVIDVSGFMFGTKMKQ 48 >UniRef50_Q82LZ6 Cluster: Putative uncharacterized protein; n=1; Streptomyces avermitilis|Rep: Putative uncharacterized protein - Streptomyces avermitilis Length = 462 Score = 54.0 bits (124), Expect = 2e-06 Identities = 26/52 (50%), Positives = 33/52 (63%) Frame = +1 Query: 325 APDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFE 480 AP PL VFV+DTSGSM+G K++ +K A+ TI EL P D II F+ Sbjct: 36 APATEPLPVNFVFVVDTSGSMTGTKLDTVKSALQTIYRELRPADCLGIITFD 87 >UniRef50_Q3IHK0 Cluster: Putative uncharacterized protein; n=2; Alteromonadales|Rep: Putative uncharacterized protein - Pseudoalteromonas haloplanktis (strain TAC 125) Length = 664 Score = 53.6 bits (123), Expect = 2e-06 Identities = 24/51 (47%), Positives = 37/51 (72%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 L + VFV+DTSGSM G+ MEQ K A++ L+ L+ D F+II F++++T+ Sbjct: 320 LARETVFVVDTSGSMHGQSMEQAKNALFYALSLLDSNDSFNIIGFDNVVTL 370 >UniRef50_A7HVH6 Cluster: Vault protein inter-alpha-trypsin domain protein precursor; n=1; Parvibaculum lavamentivorans DS-1|Rep: Vault protein inter-alpha-trypsin domain protein precursor - Parvibaculum lavamentivorans DS-1 Length = 755 Score = 52.8 bits (121), Expect = 4e-06 Identities = 25/56 (44%), Positives = 36/56 (64%) Frame = +1 Query: 328 PDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 P+ P + +FV+D SGSMSG M Q KE++ L+ L PGD F++I F+ +TV Sbjct: 342 PEAKP--REAIFVIDNSGSMSGPSMVQAKESLLWALDRLKPGDTFNVIRFDDTLTV 395 >UniRef50_A4C730 Cluster: Putative uncharacterized protein; n=1; Pseudoalteromonas tunicata D2|Rep: Putative uncharacterized protein - Pseudoalteromonas tunicata D2 Length = 684 Score = 52.8 bits (121), Expect = 4e-06 Identities = 24/47 (51%), Positives = 33/47 (70%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 L + V+FV+DTSGSM G +EQ K A++ L L+P D F+II+F S Sbjct: 328 LPREVIFVIDTSGSMHGESLEQAKSALFFALANLDPQDSFNIIEFNS 374 >UniRef50_UPI0000E87C0D Cluster: hypothetical protein MB2181_05370; n=1; Methylophilales bacterium HTCC2181|Rep: hypothetical protein MB2181_05370 - Methylophilales bacterium HTCC2181 Length = 700 Score = 51.2 bits (117), Expect = 1e-05 Identities = 22/52 (42%), Positives = 35/52 (67%) Frame = +1 Query: 337 PPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 P + V+F++D+SGSM G M+Q K+A+ + L+ GD F+IIDF++ T Sbjct: 334 PKTPREVIFIIDSSGSMHGSSMDQAKQALAEAIMRLDKGDRFNIIDFDTQFT 385 >UniRef50_Q21PJ3 Cluster: Von Willebrand factor, type A; n=1; Saccharophagus degradans 2-40|Rep: Von Willebrand factor, type A - Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) Length = 763 Score = 51.2 bits (117), Expect = 1e-05 Identities = 22/47 (46%), Positives = 34/47 (72%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 L++ +VFV+DTSGSM G ++Q K ++ L LNP D F+II+F++ Sbjct: 384 LSRDIVFVVDTSGSMQGTSIQQAKRSLQFALRGLNPSDTFNIIEFDT 430 >UniRef50_Q1VY89 Cluster: Inter-alpha-trypsin inhibitor family heavy chain-related protein- hypothetical secreted or membrane-associated; n=1; Psychroflexus torquis ATCC 700755|Rep: Inter-alpha-trypsin inhibitor family heavy chain-related protein- hypothetical secreted or membrane-associated - Psychroflexus torquis ATCC 700755 Length = 689 Score = 50.8 bits (116), Expect = 2e-05 Identities = 25/54 (46%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = +1 Query: 343 LNKYVVFVLDTSGSM-SGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITVHE 501 + K V ++D+SGSM G KM Q KEA I+N LN GD F++IDF++ I + + Sbjct: 274 IEKNFVLIIDSSGSMRGGNKMAQAKEASEFIVNNLNIGDNFNVIDFDNNIVLFQ 327 >UniRef50_Q0AMP5 Cluster: Vault protein inter-alpha-trypsin domain protein precursor; n=1; Maricaulis maris MCS10|Rep: Vault protein inter-alpha-trypsin domain protein precursor - Maricaulis maris (strain MCS10) Length = 740 Score = 50.8 bits (116), Expect = 2e-05 Identities = 22/51 (43%), Positives = 31/51 (60%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 D P + +FV+D SGSM G M Q + A+ T L L PGD F++I F++ Sbjct: 338 DTPRRARETIFVIDNSGSMGGASMRQARAALITALQRLEPGDRFNVIRFDN 388 >UniRef50_A6X8G3 Cluster: LPXTG-motif cell wall anchor domain protein precursor; n=1; Ochrobactrum anthropi ATCC 49188|Rep: LPXTG-motif cell wall anchor domain protein precursor - Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) Length = 750 Score = 50.4 bits (115), Expect = 2e-05 Identities = 21/50 (42%), Positives = 34/50 (68%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 + + V+FV+D SGSM G +EQ K ++ L++L PGD F++I F+ +T Sbjct: 350 VQREVIFVIDNSGSMGGTSIEQAKASLDYALSQLQPGDRFNVIRFDDTLT 399 >UniRef50_Q8YNZ7 Cluster: Alr4412 protein; n=4; Cyanobacteria|Rep: Alr4412 protein - Anabaena sp. (strain PCC 7120) Length = 820 Score = 49.6 bits (113), Expect = 4e-05 Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 K VVF++DTSGS G + Q +E M +N LNP D FSI+DF Sbjct: 299 KDVVFLIDTSGSQMGAPLMQCQELMRRFINGLNPDDTFSIVDF 341 >UniRef50_A5UYN7 Cluster: von Willebrand factor, type A; n=1; Roseiflexus sp. RS-1|Rep: von Willebrand factor, type A - Roseiflexus sp. RS-1 Length = 459 Score = 49.2 bits (112), Expect = 5e-05 Identities = 25/54 (46%), Positives = 33/54 (61%) Frame = +1 Query: 337 PPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITVH 498 PPL ++V VLD SGSMSG K+ KEA+ L+ L GD FS++ F + H Sbjct: 89 PPL--HLVAVLDVSGSMSGTKLASAKEALRQALHFLQDGDVFSLVTFSDQVQTH 140 >UniRef50_A0YYN3 Cluster: Von Willebrand factor, type A; n=1; Lyngbya sp. PCC 8106|Rep: Von Willebrand factor, type A - Lyngbya sp. PCC 8106 Length = 843 Score = 49.2 bits (112), Expect = 5e-05 Identities = 27/68 (39%), Positives = 36/68 (52%), Gaps = 5/68 (7%) Frame = +1 Query: 304 GYFVHFFAPDLPP-----LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSI 468 G+F + P L + K VVF++DTSGS G + + K+ M + LNP D FSI Sbjct: 322 GHFATYLIPSLEYKQDEIVAKDVVFLIDTSGSQRGEPLAKSKQLMRRFIQSLNPDDTFSI 381 Query: 469 IDFESIIT 492 IDF T Sbjct: 382 IDFSDTTT 389 >UniRef50_Q9LMB7 Cluster: F14D16.26; n=5; Magnoliophyta|Rep: F14D16.26 - Arabidopsis thaliana (Mouse-ear cress) Length = 736 Score = 49.2 bits (112), Expect = 5e-05 Identities = 22/43 (51%), Positives = 33/43 (76%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 VVFV+D S SM+G+ +E +K A+ T L++L+PGD F+II F + Sbjct: 311 VVFVVDISKSMTGKPLEDVKNAISTALSKLDPGDSFNIITFSN 353 >UniRef50_A1U6Y4 Cluster: Vault protein inter-alpha-trypsin domain protein precursor; n=1; Marinobacter aquaeolei VT8|Rep: Vault protein inter-alpha-trypsin domain protein precursor - Marinobacter aquaeolei (strain ATCC 700491 / DSM 11845 / VT8)(Marinobacter hydrocarbonoclasticus (strain DSM 11845)) Length = 712 Score = 48.8 bits (111), Expect = 7e-05 Identities = 21/47 (44%), Positives = 32/47 (68%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 L + ++FV+DTSGSM+G + Q + A+ L+ L PGD F++I F S Sbjct: 352 LRRELLFVIDTSGSMAGESIRQARSALLRGLDTLRPGDRFNVIQFNS 398 >UniRef50_Q09E12 Cluster: Inter-alpha-inhibitor H4 heavy chain, putative; n=1; Stigmatella aurantiaca DW4/3-1|Rep: Inter-alpha-inhibitor H4 heavy chain, putative - Stigmatella aurantiaca DW4/3-1 Length = 540 Score = 48.0 bits (109), Expect = 1e-04 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 5/65 (7%) Frame = +1 Query: 304 GYFVHFFAPDLPP-----LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSI 468 GYF+ AP K V FV+DTSGSM G +M+ K+A+ + LNP D F++ Sbjct: 50 GYFIALIAPKTEVSASEIAAKRVTFVIDTSGSMQGSRMQIAKDALKYCVTRLNPQDTFNV 109 Query: 469 IDFES 483 + F + Sbjct: 110 VRFST 114 >UniRef50_A5UTA6 Cluster: von Willebrand factor, type A; n=5; Chloroflexi (class)|Rep: von Willebrand factor, type A - Roseiflexus sp. RS-1 Length = 425 Score = 48.0 bits (109), Expect = 1e-04 Identities = 23/51 (45%), Positives = 32/51 (62%) Frame = +1 Query: 325 APDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 A LP L + VLD S SM G ++ Q+KEA I+++L P DYFS++ F Sbjct: 37 AQQLPKLPLNLCLVLDRSSSMRGERLMQVKEAAARIVDQLGPDDYFSLVVF 87 >UniRef50_A0P2E4 Cluster: Von Willebrand factor type A like domain; n=1; Stappia aggregata IAM 12614|Rep: Von Willebrand factor type A like domain - Stappia aggregata IAM 12614 Length = 772 Score = 47.6 bits (108), Expect = 2e-04 Identities = 27/65 (41%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = +1 Query: 304 GYFVHFFAPDLPPLNKYV-----VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSI 468 GYF P P + VFVLDTSGSMSG+ +E K M + L P DYF I Sbjct: 344 GYFSLLIEPPKLPAEDMIGQRELVFVLDTSGSMSGQPIEASKTFMTAAIKALRPDDYFRI 403 Query: 469 IDFES 483 + F + Sbjct: 404 LHFSN 408 >UniRef50_Q89VR8 Cluster: Bll0977 protein; n=3; Rhizobiales|Rep: Bll0977 protein - Bradyrhizobium japonicum Length = 754 Score = 47.2 bits (107), Expect = 2e-04 Identities = 22/52 (42%), Positives = 31/52 (59%) Frame = +1 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 PL + VVFV+D SGSM G + Q K ++ L L P D F++I F+ + V Sbjct: 352 PLPREVVFVIDNSGSMGGTSIVQAKASLLYALGRLQPADRFNVIRFDDTMDV 403 >UniRef50_A6PIB9 Cluster: Vault protein inter-alpha-trypsin domain protein; n=1; Shewanella sediminis HAW-EB3|Rep: Vault protein inter-alpha-trypsin domain protein - Shewanella sediminis HAW-EB3 Length = 770 Score = 47.2 bits (107), Expect = 2e-04 Identities = 22/50 (44%), Positives = 34/50 (68%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 +++ ++ V+DTSGSMSG MEQ K+AM L L D F++I+F S ++ Sbjct: 373 VSRELILVIDTSGSMSGSAMEQAKKAMKYALAGLGSDDTFNVIEFNSKVS 422 >UniRef50_A5E9T8 Cluster: Putative uncharacterized protein; n=2; Bradyrhizobium|Rep: Putative uncharacterized protein - Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) Length = 755 Score = 47.2 bits (107), Expect = 2e-04 Identities = 21/52 (40%), Positives = 31/52 (59%) Frame = +1 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 P + V+FV+D SGSM G + Q K ++ L L P D F++I F+ +TV Sbjct: 354 PQPRDVIFVIDNSGSMGGTSIRQAKASLLYALGRLQPNDRFNVIRFDDTMTV 405 >UniRef50_Q7ULL3 Cluster: Putative uncharacterized protein; n=1; Pirellula sp.|Rep: Putative uncharacterized protein - Rhodopirellula baltica Length = 484 Score = 46.8 bits (106), Expect = 3e-04 Identities = 24/57 (42%), Positives = 37/57 (64%) Frame = +1 Query: 325 APDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 A + PP+N V VLD SGSMSG+K+ + KEA ++ L+ D S++ ++S +TV Sbjct: 79 AEERPPVN--VCLVLDHSGSMSGQKLARAKEAAEAAIDRLSDDDIVSVVLYDSNVTV 133 >UniRef50_Q4S6B8 Cluster: Chromosome 9 SCAF14729, whole genome shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome 9 SCAF14729, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 476 Score = 46.4 bits (105), Expect = 4e-04 Identities = 21/51 (41%), Positives = 34/51 (66%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 DL ++ +F++D SGSMSG + ++K+AM +L L PG +F+I+ F S Sbjct: 411 DLRKVHGEFIFLVDRSGSMSGVNINRVKDAMVVMLKSLMPGCFFNIVGFGS 461 >UniRef50_A2Y022 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 854 Score = 46.4 bits (105), Expect = 4e-04 Identities = 20/45 (44%), Positives = 29/45 (64%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 VV VLD SGSM G ++E +KEAM + +L P D S++ F + + Sbjct: 76 VVAVLDVSGSMEGERLEHVKEAMEIFIGKLGPDDRLSVVSFATSV 120 >UniRef50_A4J6Q3 Cluster: Von Willebrand factor, type A; n=1; Desulfotomaculum reducens MI-1|Rep: Von Willebrand factor, type A - Desulfotomaculum reducens MI-1 Length = 416 Score = 46.0 bits (104), Expect = 5e-04 Identities = 18/45 (40%), Positives = 32/45 (71%) Frame = +1 Query: 361 FVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 FV+D SGSM+G K++ K+A+ + L+P DY S++ F+ ++T+ Sbjct: 46 FVIDRSGSMAGEKLDYTKKAVAFAVGHLSPQDYCSVVAFDDMVTM 90 >UniRef50_Q1DE81 Cluster: Von Willebrand factor type A domain protein; n=2; Cystobacterineae|Rep: Von Willebrand factor type A domain protein - Myxococcus xanthus (strain DK 1622) Length = 860 Score = 45.6 bits (103), Expect = 6e-04 Identities = 26/65 (40%), Positives = 35/65 (53%), Gaps = 5/65 (7%) Frame = +1 Query: 304 GYFVHFFAPDL-----PPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSI 468 G F PDL P + VVFV+D SGSM+G + Q + A+ L L GD F++ Sbjct: 262 GTFALTVVPDLLALASAPPKQEVVFVVDVSGSMAGESLPQAQAALRLCLRHLREGDRFNV 321 Query: 469 IDFES 483 I FE+ Sbjct: 322 IAFEN 326 >UniRef50_Q1NTK1 Cluster: Von Willebrand factor, type A; n=3; cellular organisms|Rep: Von Willebrand factor, type A - delta proteobacterium MLMS-1 Length = 771 Score = 45.2 bits (102), Expect = 8e-04 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 5/67 (7%) Frame = +1 Query: 298 NDGYF-VHFFAPDLPPLNKYV----VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYF 462 N GY + F+P LPP + + +LD SGSM+G + Q K+A+ +LN L P DY Sbjct: 243 NGGYVALASFSPRLPPSEQPIPTSLAILLDCSGSMAGDSIAQAKQAISDMLNLLRPEDYC 302 Query: 463 SIIDFES 483 ++I F S Sbjct: 303 NLIMFGS 309 >UniRef50_Q2SQR4 Cluster: Uncharacterized protein containing a von Willebrand factor type A (VWA) domain; n=1; Hahella chejuensis KCTC 2396|Rep: Uncharacterized protein containing a von Willebrand factor type A (VWA) domain - Hahella chejuensis (strain KCTC 2396) Length = 733 Score = 44.8 bits (101), Expect = 0.001 Identities = 19/47 (40%), Positives = 33/47 (70%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 L + +++V+DTSGSM G ++Q ++A+ L+ L P D F++I+F S Sbjct: 354 LPRELIWVVDTSGSMEGVSIQQARDAVLQALDTLTPRDRFNVIEFNS 400 >UniRef50_Q0AV90 Cluster: Putative uncharacterized protein; n=1; Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep: Putative uncharacterized protein - Syntrophomonas wolfei subsp. wolfei (strain Goettingen) Length = 776 Score = 44.8 bits (101), Expect = 0.001 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 5/66 (7%) Frame = +1 Query: 301 DGYFVHF-FAPDLPPLN----KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFS 465 D YF + P+LP + K +F++D S SM G+K+E +A+ L L+ GD F+ Sbjct: 256 DEYFACITYTPELPIIEQRQPKEYIFLIDISRSMEGKKIEHAADAIQICLRNLDEGDSFN 315 Query: 466 IIDFES 483 ++ FES Sbjct: 316 LLAFES 321 >UniRef50_A5NZ29 Cluster: LPXTG-motif cell wall anchor domain precursor; n=3; Methylobacterium|Rep: LPXTG-motif cell wall anchor domain precursor - Methylobacterium sp. 4-46 Length = 761 Score = 44.8 bits (101), Expect = 0.001 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFE 480 V FV+D SGSM+G M Q K ++ L+ L P D F++I F+ Sbjct: 375 VTFVIDNSGSMAGASMRQAKASLLVALDRLGPADRFNVIRFD 416 >UniRef50_A7PDU4 Cluster: Chromosome chr11 scaffold_13, whole genome shotgun sequence; n=3; core eudicotyledons|Rep: Chromosome chr11 scaffold_13, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 756 Score = 44.8 bits (101), Expect = 0.001 Identities = 23/49 (46%), Positives = 31/49 (63%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 K VVFV+D SGSM G+ +E K A+ L++L+ D FSII F I + Sbjct: 324 KEVVFVVDISGSMRGKLLEDTKNALSAALSKLDSKDSFSIIAFNGEIFI 372 >UniRef50_A7RKA1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1128 Score = 44.8 bits (101), Expect = 0.001 Identities = 22/48 (45%), Positives = 30/48 (62%) Frame = +1 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 P K V+ V+D SGSM G ++ KEA T+L+ LNP D + + FES Sbjct: 208 PQPKDVILVVDYSGSMGGSRLPIAKEAAKTVLDTLNPRDRVAFLAFES 255 >UniRef50_UPI0000EB3B8C Cluster: Novel protein.; n=2; Canis lupus familiaris|Rep: Novel protein. - Canis familiaris Length = 444 Score = 44.4 bits (100), Expect = 0.001 Identities = 24/72 (33%), Positives = 38/72 (52%) Frame = +1 Query: 268 DRPKDGQILVNDGYFVHFFAPDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELN 447 D P I++N + P+L + +F++D SGSMSG + ++K+AM L L Sbjct: 50 DIPHHSVIMLNFCPDLQSVQPNLRKTHGEFIFLIDRSGSMSGTNIHRVKDAMLVALKSLM 109 Query: 448 PGDYFSIIDFES 483 P F++I F S Sbjct: 110 PACLFNVIGFGS 121 >UniRef50_Q4RV83 Cluster: Chromosome 15 SCAF14992, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 15 SCAF14992, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1434 Score = 44.4 bits (100), Expect = 0.001 Identities = 21/53 (39%), Positives = 33/53 (62%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 +L + ++F++D SGSMSG K++ +KEAM L L PG +I+ F + I Sbjct: 409 ELHRATRELLFLVDRSGSMSGTKIQSVKEAMVIALKSLPPGTKLNIVGFGTTI 461 >UniRef50_Q083T9 Cluster: Vault protein inter-alpha-trypsin domain protein precursor; n=1; Shewanella frigidimarina NCIMB 400|Rep: Vault protein inter-alpha-trypsin domain protein precursor - Shewanella frigidimarina (strain NCIMB 400) Length = 722 Score = 44.4 bits (100), Expect = 0.001 Identities = 21/47 (44%), Positives = 32/47 (68%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 ++ V+DTSGSMSG+ + Q K+A+ L L D F+II+F S +T+ Sbjct: 346 LILVIDTSGSMSGQSITQAKQALQFALAGLRDIDSFNIIEFNSDVTM 392 >UniRef50_Q2QSE5 Cluster: Von Willebrand factor type A domain containing protein, expressed; n=3; Oryza sativa|Rep: Von Willebrand factor type A domain containing protein, expressed - Oryza sativa subsp. japonica (Rice) Length = 524 Score = 44.4 bits (100), Expect = 0.001 Identities = 20/43 (46%), Positives = 30/43 (69%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +V V+D SGSM G K+E +K+A+ ++ +L P D SI+ FES Sbjct: 63 LVAVVDVSGSMRGHKIESVKKALQFVIMKLTPVDRLSIVTFES 105 >UniRef50_Q47YR5 Cluster: Von Willebrand factor type A domain protein; n=2; cellular organisms|Rep: Von Willebrand factor type A domain protein - Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibriopsychroerythus) Length = 786 Score = 44.0 bits (99), Expect = 0.002 Identities = 19/43 (44%), Positives = 29/43 (67%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 ++F++DTSGSM MEQ K ++ L +LN D F+II F++ Sbjct: 396 IIFIIDTSGSMQAGSMEQAKSSLQLALLQLNNKDSFNIIAFDN 438 >UniRef50_Q1YZ74 Cluster: Inter-alpha-trypsin inhibitor domain protein; n=1; Photobacterium profundum 3TCK|Rep: Inter-alpha-trypsin inhibitor domain protein - Photobacterium profundum 3TCK Length = 714 Score = 44.0 bits (99), Expect = 0.002 Identities = 21/41 (51%), Positives = 27/41 (65%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 V FVLD SGSM G +EQ K+A+ L +L P D F+I+ F Sbjct: 335 VTFVLDISGSMYGESIEQAKQALRYGLQQLQPEDSFNIVTF 375 >UniRef50_A6F3R5 Cluster: Putative uncharacterized protein; n=1; Marinobacter algicola DG893|Rep: Putative uncharacterized protein - Marinobacter algicola DG893 Length = 718 Score = 44.0 bits (99), Expect = 0.002 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 L + +VFV+DTSGSM+G + Q ++A+ L L+ D F++I F S Sbjct: 352 LPRELVFVIDTSGSMAGESIRQARQALLRGLGTLDADDRFNVIQFNS 398 >UniRef50_Q10RY0 Cluster: Zinc finger family protein, putative, expressed; n=2; Oryza sativa|Rep: Zinc finger family protein, putative, expressed - Oryza sativa subsp. japonica (Rice) Length = 694 Score = 44.0 bits (99), Expect = 0.002 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +V VLD SGSMSG K+ LK AM ++ L P D S++ F S Sbjct: 248 LVTVLDVSGSMSGIKLSLLKRAMSFVIQTLGPNDRLSVVAFSS 290 >UniRef50_Q7UL83 Cluster: Inter-alpha-trypsin inhibitor family heavy chain-related protein- hypothetical secreted or membrane-associated protein containing vWFA domain; n=1; Pirellula sp.|Rep: Inter-alpha-trypsin inhibitor family heavy chain-related protein- hypothetical secreted or membrane-associated protein containing vWFA domain - Rhodopirellula baltica Length = 764 Score = 43.6 bits (98), Expect = 0.003 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITVHE 501 V+ VLDTSGSM+G + QL+ +L+ LNP D F +I F + T + Sbjct: 345 VILVLDTSGSMNGPAISQLRLFADHVLDHLNPNDEFRVIAFSNRTTAFQ 393 >UniRef50_Q21MJ3 Cluster: Von Willebrand factor, type A; n=1; Saccharophagus degradans 2-40|Rep: Von Willebrand factor, type A - Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) Length = 708 Score = 43.6 bits (98), Expect = 0.003 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Frame = +1 Query: 265 VDRP-KDGQILVNDGYFVHFFAPDLPPLNKYVVFVLDTSGSMSGR-KMEQLKEAMYTILN 438 +D P G+ LV+ G + APD P +VF+LD SGSM+ + K+ +K++M +L+ Sbjct: 316 IDSPWAKGKKLVHIGLKGYDIAPDQKPRTN-LVFLLDVSGSMNSQDKLPLVKQSMEMLLS 374 Query: 439 ELNPGDYFSII 471 LNP D +I+ Sbjct: 375 TLNPDDTVAIV 385 >UniRef50_Q6ZFR3 Cluster: Zinc finger (C3HC4-type RING finger) protein family-like; n=8; Oryza sativa|Rep: Zinc finger (C3HC4-type RING finger) protein family-like - Oryza sativa subsp. japonica (Rice) Length = 704 Score = 43.6 bits (98), Expect = 0.003 Identities = 19/41 (46%), Positives = 28/41 (68%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 +V VLD SGSM G K+ LK AM ++++L PGD +++ F Sbjct: 233 LVTVLDVSGSMEGYKLTLLKRAMGFVIDKLGPGDRLAVVSF 273 >UniRef50_Q3A188 Cluster: Von Willebrand factor type A domain protein; n=1; Pelobacter carbinolicus DSM 2380|Rep: Von Willebrand factor type A domain protein - Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) Length = 442 Score = 43.2 bits (97), Expect = 0.003 Identities = 20/51 (39%), Positives = 32/51 (62%) Frame = +1 Query: 337 PPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 PP+N + VLD SGSMSG K+ + +EA + L+ GD FS++ ++ + Sbjct: 64 PPVN--LALVLDRSGSMSGNKIAKAREAAIEAVRRLSDGDLFSLVVYDDSV 112 >UniRef50_Q15NW6 Cluster: Vault protein inter-alpha-trypsin; n=1; Pseudoalteromonas atlantica T6c|Rep: Vault protein inter-alpha-trypsin - Pseudoalteromonas atlantica (strain T6c / BAA-1087) Length = 701 Score = 43.2 bits (97), Expect = 0.003 Identities = 21/44 (47%), Positives = 29/44 (65%) Frame = +1 Query: 346 NKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 ++ VVF+LDTSGSM+G + Q K A+ L +L P D +II F Sbjct: 302 SREVVFLLDTSGSMAGESIVQAKRAVDFALTQLRPEDNVNIIQF 345 >UniRef50_A1S752 Cluster: Inter-alpha-trypsin inhibitor domain protein precursor; n=1; Shewanella amazonensis SB2B|Rep: Inter-alpha-trypsin inhibitor domain protein precursor - Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) Length = 753 Score = 43.2 bits (97), Expect = 0.003 Identities = 22/47 (46%), Positives = 29/47 (61%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 L + +V V+DTSGSM+G M Q + A+ L L P D F+II F S Sbjct: 395 LARELVLVIDTSGSMAGDSMVQARSALIHALGGLGPQDSFNIIAFSS 441 >UniRef50_Q9FF49 Cluster: Retroelement pol polyprotein-like; n=18; Magnoliophyta|Rep: Retroelement pol polyprotein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 704 Score = 43.2 bits (97), Expect = 0.003 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +V VLD SGSM+G K+ LK AM ++ L P D S+I F S Sbjct: 253 LVTVLDVSGSMAGTKLALLKRAMGFVIQNLGPFDRLSVISFSS 295 >UniRef50_A7QCT4 Cluster: Chromosome undetermined scaffold_79, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome undetermined scaffold_79, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 674 Score = 43.2 bits (97), Expect = 0.003 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +V VLD SGSM+G K+ LK A+ ++ L P D SI+ F S Sbjct: 215 LVAVLDVSGSMAGSKLSLLKRAVCFLIQNLGPSDRLSIVSFSS 257 >UniRef50_A5B5Z1 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 686 Score = 43.2 bits (97), Expect = 0.003 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +V VLD SGSM+G K+ LK A+ ++ L P D SI+ F S Sbjct: 205 LVAVLDVSGSMAGSKLSLLKRAVCFLIQNLGPSDRLSIVSFSS 247 >UniRef50_Q8YP40 Cluster: Alr4360 protein; n=8; Nostocaceae|Rep: Alr4360 protein - Anabaena sp. (strain PCC 7120) Length = 427 Score = 42.7 bits (96), Expect = 0.004 Identities = 21/52 (40%), Positives = 32/52 (61%) Frame = +1 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 PLN + +LD SGSM G+ ++ + EA+ +L+ L PGD S++ F TV Sbjct: 41 PLN--LCLILDQSGSMHGQPLKMVVEAVEKLLDRLQPGDRISVVAFAGSATV 90 >UniRef50_Q8H923 Cluster: Putative uncharacterized protein OSJNBa0071K18.17; n=3; Oryza sativa|Rep: Putative uncharacterized protein OSJNBa0071K18.17 - Oryza sativa subsp. japonica (Rice) Length = 606 Score = 42.7 bits (96), Expect = 0.004 Identities = 18/43 (41%), Positives = 29/43 (67%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +V VLD SGSM+GRK+ +K+AM +++ L P D ++ F + Sbjct: 145 LVTVLDVSGSMAGRKLALVKKAMGFVIDNLGPADRLCVVSFST 187 >UniRef50_Q7G2L9 Cluster: Von Willebrand factor type A domain containing protein, expressed; n=4; Oryza sativa|Rep: Von Willebrand factor type A domain containing protein, expressed - Oryza sativa subsp. japonica (Rice) Length = 719 Score = 42.7 bits (96), Expect = 0.004 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +V VLD S SM+G K+ LK AM ++ L PGD S++ F S Sbjct: 262 LVTVLDVSWSMAGTKLALLKRAMSFVIQALGPGDRLSVVTFSS 304 >UniRef50_Q231J4 Cluster: Von Willebrand factor type A domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 520 Score = 42.7 bits (96), Expect = 0.004 Identities = 17/43 (39%), Positives = 31/43 (72%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 ++FV+DTSGSM G+K+E +K+++ +L+ + D S++ F S Sbjct: 98 LIFVIDTSGSMQGKKIELVKKSILQVLHIIQGDDRISLVGFNS 140 >UniRef50_Q22X70 Cluster: Von Willebrand factor type A domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 783 Score = 42.7 bits (96), Expect = 0.004 Identities = 21/51 (41%), Positives = 33/51 (64%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 D PL+ ++FV+D S SM G+KM QLK+ + ++N LN D ++I F + Sbjct: 81 DRQPLD--LIFVIDLSISMRGKKMNQLKKTICNLINFLNENDRMALIGFNN 129 >UniRef50_A6GAI6 Cluster: Putative uncharacterized protein; n=1; Plesiocystis pacifica SIR-1|Rep: Putative uncharacterized protein - Plesiocystis pacifica SIR-1 Length = 560 Score = 42.3 bits (95), Expect = 0.006 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 2/89 (2%) Frame = +1 Query: 223 AGEGVLGQFVVQYDVDRPKD-GQILVNDGYFVHFFAPD-LPPLNKYVVFVLDTSGSMSGR 396 A +G L + ++ D + + G P+ PP+N V VLDTSGSM+G Sbjct: 177 AADGELSVYAAMNPIEGEGDEARFQMQIGVASELMTPEERPPMN--VTLVLDTSGSMAGT 234 Query: 397 KMEQLKEAMYTILNELNPGDYFSIIDFES 483 +E L+E I +L GD SI ++++ Sbjct: 235 PIELLRETSRAIAAQLKLGDTVSICEWDT 263 >UniRef50_A6G415 Cluster: von Willebrand factor, type A; n=1; Plesiocystis pacifica SIR-1|Rep: von Willebrand factor, type A - Plesiocystis pacifica SIR-1 Length = 877 Score = 42.3 bits (95), Expect = 0.006 Identities = 19/43 (44%), Positives = 28/43 (65%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 ++FV+D SGSMSG + K+ + L+ L P D F++I FES Sbjct: 375 MIFVIDRSGSMSGVPLALAKQTLREALSHLRPVDTFNVISFES 417 >UniRef50_A6G2V8 Cluster: von Willebrand factor, type A; n=1; Plesiocystis pacifica SIR-1|Rep: von Willebrand factor, type A - Plesiocystis pacifica SIR-1 Length = 877 Score = 42.3 bits (95), Expect = 0.006 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 13/90 (14%) Frame = +1 Query: 247 FVVQYDVDRPKDGQILV--------NDGYFVHFFAP-----DLPPLNKYVVFVLDTSGSM 387 FVV +D+ R + +V DGYF P D + + +VFV+D SGSM Sbjct: 328 FVVSWDLGRDQPKAAIVAQPPTSEGGDGYFTLTVQPPEQVADEQAVARELVFVVDNSGSM 387 Query: 388 SGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 G M+ K M L ++ P D F+++ F Sbjct: 388 GGLPMDTAKGLMRKALKDIRPDDTFTVLRF 417 >UniRef50_Q9LN03 Cluster: T6D22.13; n=2; Arabidopsis thaliana|Rep: T6D22.13 - Arabidopsis thaliana (Mouse-ear cress) Length = 641 Score = 42.3 bits (95), Expect = 0.006 Identities = 20/44 (45%), Positives = 27/44 (61%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESI 486 ++ VLD SGSM G KME +K AM ++ L D S+I F S+ Sbjct: 205 LITVLDVSGSMDGVKMELMKNAMSFVIQNLGETDRLSVISFSSM 248 >UniRef50_UPI0000F2D28F Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 998 Score = 41.9 bits (94), Expect = 0.008 Identities = 21/42 (50%), Positives = 27/42 (64%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +F++D SGSMSG M +K+AM IL L P F+II F S Sbjct: 403 IFLIDRSGSMSGVNMHLVKDAMILILKSLMPTCLFNIIGFGS 444 >UniRef50_Q1JWY1 Cluster: Von Willebrand factor, type A precursor; n=2; Deltaproteobacteria|Rep: Von Willebrand factor, type A precursor - Desulfuromonas acetoxidans DSM 684 Length = 698 Score = 41.9 bits (94), Expect = 0.008 Identities = 28/78 (35%), Positives = 39/78 (50%), Gaps = 2/78 (2%) Frame = +1 Query: 250 VVQYDVDRPKDGQILVNDGYFVHFFAPDLPPLNKYV--VFVLDTSGSMSGRKMEQLKEAM 423 ++ Y DR G +++ V A DL P+ + FVLD SGSM G K+ L + + Sbjct: 278 LIPYKADRNATGTMML-----VVTPAADLQPITEGTDWTFVLDVSGSMDGHKIATLADGV 332 Query: 424 YTILNELNPGDYFSIIDF 477 L +LN D F II F Sbjct: 333 SQTLGKLNSNDRFRIITF 350 >UniRef50_Q10ZP7 Cluster: Von Willebrand factor, type A; n=1; Trichodesmium erythraeum IMS101|Rep: Von Willebrand factor, type A - Trichodesmium erythraeum (strain IMS101) Length = 420 Score = 41.9 bits (94), Expect = 0.008 Identities = 19/54 (35%), Positives = 31/54 (57%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 +LP L + LDTS SM G K+++ KEA +++ L DY S+ + + +T Sbjct: 39 NLPSLPIRMAIALDTSQSMKGEKLQRAKEACLAVVSHLRDPDYLSLAGYSTRVT 92 >UniRef50_A3W9L9 Cluster: Putative uncharacterized protein; n=2; Erythrobacter|Rep: Putative uncharacterized protein - Erythrobacter sp. NAP1 Length = 740 Score = 41.9 bits (94), Expect = 0.008 Identities = 19/54 (35%), Positives = 32/54 (59%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 + PP + ++FV+D SGSM+G M + ++ L L P D F++I F+ +T Sbjct: 340 EAPP--REMIFVIDNSGSMAGESMPAARRSLLYALETLRPQDRFNVIRFDDTMT 391 >UniRef50_A0X7B2 Cluster: LPXTG-motif cell wall anchor domain precursor; n=1; Shewanella pealeana ATCC 700345|Rep: LPXTG-motif cell wall anchor domain precursor - Shewanella pealeana ATCC 700345 Length = 789 Score = 41.9 bits (94), Expect = 0.008 Identities = 20/47 (42%), Positives = 30/47 (63%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +++ ++ V+DTSGSMSG + Q K A+ L L P D F+I+ F S Sbjct: 397 IHRELILVIDTSGSMSGDAIIQAKTALKYALAGLRPTDKFNIVQFNS 443 >UniRef50_A0JAF2 Cluster: Vault protein inter-alpha-trypsin precursor; n=1; Shewanella woodyi ATCC 51908|Rep: Vault protein inter-alpha-trypsin precursor - Shewanella woodyi ATCC 51908 Length = 739 Score = 41.5 bits (93), Expect = 0.010 Identities = 19/47 (40%), Positives = 30/47 (63%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +++ ++ V+DTSGSMSG + Q K A+ L L D F++I+F S Sbjct: 361 ISRELILVIDTSGSMSGASIAQAKRALNYALAGLKAKDTFNVIEFNS 407 >UniRef50_Q24CQ9 Cluster: Von Willebrand factor type A domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 856 Score = 41.5 bits (93), Expect = 0.010 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 +F+LD SGSM+GR +++ EA+ L L P YF++ F Sbjct: 322 IFLLDRSGSMNGRPIKKATEALNLFLKSLPPNSYFNVYSF 361 >UniRef50_A0CDA1 Cluster: Chromosome undetermined scaffold_17, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_17, whole genome shotgun sequence - Paramecium tetraurelia Length = 604 Score = 41.5 bits (93), Expect = 0.010 Identities = 18/39 (46%), Positives = 26/39 (66%) Frame = +1 Query: 364 VLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFE 480 V+D SGSMSG K+E +K+ + +LN L P D +I F+ Sbjct: 190 VIDRSGSMSGEKIEMVKQTLNILLNFLGPKDRLCLIQFD 228 >UniRef50_UPI0000E105CF Cluster: hypothetical protein OM2255_14600; n=1; alpha proteobacterium HTCC2255|Rep: hypothetical protein OM2255_14600 - alpha proteobacterium HTCC2255 Length = 757 Score = 41.1 bits (92), Expect = 0.014 Identities = 19/49 (38%), Positives = 31/49 (63%) Frame = +1 Query: 337 PPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 P + + +FVLD+SGSM G + Q +A+ ++ L D F+I+DF+S Sbjct: 386 PSIQQNTIFVLDSSGSMHGTALTQAIDAIREGVSYLTEHDTFNIVDFDS 434 >UniRef50_Q2BJ22 Cluster: Putative uncharacterized protein; n=1; Neptuniibacter caesariensis|Rep: Putative uncharacterized protein - Neptuniibacter caesariensis Length = 445 Score = 41.1 bits (92), Expect = 0.014 Identities = 18/47 (38%), Positives = 28/47 (59%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 + VLD SGSM G K+ + KEA +N L+ D S++ ++S + V Sbjct: 72 IAIVLDKSGSMQGDKLFRAKEAAIMAINRLSQNDIVSVVSYDSRVNV 118 >UniRef50_Q7SGD8 Cluster: Putative uncharacterized protein NCU00984.1; n=2; Sordariales|Rep: Putative uncharacterized protein NCU00984.1 - Neurospora crassa Length = 1086 Score = 41.1 bits (92), Expect = 0.014 Identities = 21/51 (41%), Positives = 28/51 (54%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +LP +VFV D SGSM G ++E LK A+ L + G F+I F S Sbjct: 288 NLPSTRPEIVFVCDRSGSMGGARIEGLKSALRIFLKSIPVGAKFNICSFGS 338 >UniRef50_UPI00006CC94A Cluster: von Willebrand factor type A domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 901 Score = 40.7 bits (91), Expect = 0.018 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +F++D SGSM G+ + + EA+ L L P YF+I+ F S Sbjct: 324 IFLIDRSGSMRGKPLTKALEALQLFLQSLPPDSYFNIVSFGS 365 >UniRef50_Q8EF10 Cluster: Inter-alpha-trypsin inhibitor domain protein; n=11; Shewanella|Rep: Inter-alpha-trypsin inhibitor domain protein - Shewanella oneidensis Length = 760 Score = 40.7 bits (91), Expect = 0.018 Identities = 20/51 (39%), Positives = 32/51 (62%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 L + ++ V+DTSGSM+G + Q K A+ L L D F+II+F S +++ Sbjct: 376 LPRELILVIDTSGSMAGDSIIQAKNALRYALRGLKAQDSFNIIEFNSDVSL 426 >UniRef50_Q7JMF9 Cluster: Putative uncharacterized protein tag-180; n=3; Caenorhabditis|Rep: Putative uncharacterized protein tag-180 - Caenorhabditis elegans Length = 1067 Score = 40.7 bits (91), Expect = 0.018 Identities = 20/45 (44%), Positives = 28/45 (62%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 K +VF+LD SGS+ G M +K M IL+ L+P DYF + F + Sbjct: 233 KDIVFLLDYSGSVKGPTMHLIKITMMYILSTLSPNDYFFGVYFNN 277 >UniRef50_Q0M4B8 Cluster: Von Willebrand factor, type A precursor; n=2; Alphaproteobacteria|Rep: Von Willebrand factor, type A precursor - Caulobacter sp. K31 Length = 592 Score = 40.3 bits (90), Expect = 0.024 Identities = 20/48 (41%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +1 Query: 337 PPLNKYVVFVLDTSGSMSG-RKMEQLKEAMYTILNELNPGDYFSIIDF 477 PPLN +VF++DTSGSMSG ++ K+A+ ++++L P D S++ + Sbjct: 228 PPLN--LVFLIDTSGSMSGPDRLPLAKKALNVLIDQLRPQDRVSMVAY 273 >UniRef50_Q54DU5 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 932 Score = 40.3 bits (90), Expect = 0.024 Identities = 19/42 (45%), Positives = 27/42 (64%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +FVLD SGSMSG+ +E+ K A+ + LN F+I+ F S Sbjct: 344 IFVLDCSGSMSGKPIEKSKMALEICMRSLNENSKFNIVCFGS 385 >UniRef50_Q24FW2 Cluster: Von Willebrand factor type A domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 1074 Score = 40.3 bits (90), Expect = 0.024 Identities = 18/52 (34%), Positives = 33/52 (63%) Frame = +1 Query: 337 PPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 PP++ ++ V+D SGSM G K+ LKE + ++++L+ D ++ F S +T Sbjct: 362 PPID--LICVMDNSGSMHGEKINMLKETLLYLIDQLDEKDRLGLVLFNSEVT 411 >UniRef50_P34374 Cluster: Voltage-dependent calcium channel unc-36 precursor; n=3; Caenorhabditis|Rep: Voltage-dependent calcium channel unc-36 precursor - Caenorhabditis elegans Length = 1249 Score = 40.3 bits (90), Expect = 0.024 Identities = 19/44 (43%), Positives = 28/44 (63%) Frame = +1 Query: 346 NKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 +K V+ +LD SGSM G++ E K+ IL L+ DYF+I+ F Sbjct: 248 SKNVLIMLDMSGSMLGQRYEVAKQTTEAILETLSHNDYFNIMTF 291 >UniRef50_Q7NFR7 Cluster: Gll3457 protein; n=4; Cyanobacteria|Rep: Gll3457 protein - Gloeobacter violaceus Length = 596 Score = 39.9 bits (89), Expect = 0.031 Identities = 17/45 (37%), Positives = 30/45 (66%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 VV V+D+SGSM G K+ +++ + ++ L P + ++IDF+S I Sbjct: 417 VVLVIDSSGSMKGDKLPAVQQTLQAYIDGLGPKETIALIDFDSDI 461 >UniRef50_A4IRF6 Cluster: Putative uncharacterized protein; n=1; Geobacillus thermodenitrificans NG80-2|Rep: Putative uncharacterized protein - Geobacillus thermodenitrificans (strain NG80-2) Length = 668 Score = 39.9 bits (89), Expect = 0.031 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 4/55 (7%) Frame = +1 Query: 325 APDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILN----ELNPGDYFSIIDF 477 AP PP++ VVFV+D SGSM+ K++ K A+ +N +P D F++I F Sbjct: 191 APVRPPID--VVFVMDVSGSMTTMKLQSAKSALQAAVNYFKTNYHPNDRFALIPF 243 >UniRef50_A4EE97 Cluster: Von Willebrand factor, type A; n=5; Rhodobacteraceae|Rep: Von Willebrand factor, type A - Roseobacter sp. CCS2 Length = 699 Score = 39.9 bits (89), Expect = 0.031 Identities = 20/48 (41%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = +1 Query: 337 PPLNKYVVFVLDTSGSMSG-RKMEQLKEAMYTILNELNPGDYFSIIDF 477 PPLN +VF++DTSGSM K+ LK++ +L++L P D +I+++ Sbjct: 343 PPLN--LVFLIDTSGSMDDPTKLPLLKQSFRLMLDQLRPEDQVAIVEY 388 >UniRef50_Q9ZQ46 Cluster: Copia-like retroelement pol polyprotein; n=6; Arabidopsis thaliana|Rep: Copia-like retroelement pol polyprotein - Arabidopsis thaliana (Mouse-ear cress) Length = 683 Score = 39.9 bits (89), Expect = 0.031 Identities = 21/43 (48%), Positives = 26/43 (60%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +V VLD SG SG K+E LK+ M +L+ L D SII F S Sbjct: 303 LVAVLDVSGRNSGGKLEMLKQTMRIVLSNLREMDRLSIIAFSS 345 >UniRef50_Q22SJ4 Cluster: Von Willebrand factor type A domain containing protein; n=6; Tetrahymena thermophila SB210|Rep: Von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 646 Score = 39.9 bits (89), Expect = 0.031 Identities = 19/47 (40%), Positives = 29/47 (61%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 +V V+D SGSM G K++ +K + +L+ LN D S+I F S T+ Sbjct: 210 LVCVIDNSGSMQGEKIQNVKTTLLQLLDMLNSNDRLSLILFNSYPTL 256 >UniRef50_A7RTF3 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 756 Score = 39.9 bits (89), Expect = 0.031 Identities = 33/148 (22%), Positives = 71/148 (47%), Gaps = 3/148 (2%) Frame = +1 Query: 49 IRTGNEV-DATKDDAQMSNVIIQREGTSAVITFSPDL--EEQKRLMHVYAEKSKESATGE 219 +++ +E+ + T ++++ VI + A + + + ++M + + AT E Sbjct: 179 VQSASEIQEITSPHSKLNVVISSEDKCQATVRLAEPFKFDVDVKVMILNRDPFLPQATFE 238 Query: 220 NAGEGVLGQFVVQYDVDRPKDGQILVNDGYFVHFFAPDLPPLNKYVVFVLDTSGSMSGRK 399 N GV G + Q +++P LV + F + +++ FV+D SGSMSG + Sbjct: 239 N---GVTGSNITQDFLEKP-----LVTLNFMPDFGKQEALETGEFI-FVIDRSGSMSGDR 289 Query: 400 MEQLKEAMYTILNELNPGDYFSIIDFES 483 ++ +E ++ L L +F+++ F S Sbjct: 290 IKNARETLFLFLKSLPEHCHFNVVGFGS 317 >UniRef50_A0CY84 Cluster: Chromosome undetermined scaffold_307, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_307, whole genome shotgun sequence - Paramecium tetraurelia Length = 625 Score = 39.9 bits (89), Expect = 0.031 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 4/72 (5%) Frame = +1 Query: 274 PKDGQILVNDGYFVHFFA---PDLPPLNK-YVVFVLDTSGSMSGRKMEQLKEAMYTILNE 441 PK ++ ++D Y + D +N+ +F++D SGSMSG ++E+ K+A+ L Sbjct: 370 PKFNEVSLDDAYTQYLDGLSIADNQVINRGNYLFIIDRSGSMSGSRIEKAKQALILFLKS 429 Query: 442 LNPGDYFSIIDF 477 L F+II F Sbjct: 430 LPQDSEFNIISF 441 >UniRef50_Q0URV5 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 1162 Score = 39.9 bits (89), Expect = 0.031 Identities = 22/50 (44%), Positives = 27/50 (54%) Frame = +1 Query: 334 LPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 LP +VFV D SGSM+G ME K+A+ L L G F+I F S Sbjct: 292 LPAEKPELVFVCDRSGSMNGTSMELAKQALKVFLKSLPVGVKFNICSFGS 341 >UniRef50_A5UWY7 Cluster: von Willebrand factor, type A; n=5; Chloroflexi (class)|Rep: von Willebrand factor, type A - Roseiflexus sp. RS-1 Length = 412 Score = 39.5 bits (88), Expect = 0.042 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +1 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 PLN VLD SGSM G K+ LK+A+ ++ L P D +I+ F+ + Sbjct: 41 PLN--FCLVLDRSGSMQGAKLAALKDAVKRVIETLTPQDIVAIVLFDDTV 88 >UniRef50_A1ZUW0 Cluster: Von Willebrand factor, type A; n=1; Microscilla marina ATCC 23134|Rep: Von Willebrand factor, type A - Microscilla marina ATCC 23134 Length = 425 Score = 39.5 bits (88), Expect = 0.042 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +1 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 PLN + V+D SGSMSG K+ +K+A+ +++ L D SI+ ++ I V Sbjct: 44 PLN--ISLVVDRSGSMSGDKLNYVKKAVDFVIDNLKSDDVLSIVQYDDEIDV 93 >UniRef50_Q2V3P2 Cluster: Uncharacterized protein At3g54780.3; n=6; core eudicotyledons|Rep: Uncharacterized protein At3g54780.3 - Arabidopsis thaliana (Mouse-ear cress) Length = 633 Score = 39.5 bits (88), Expect = 0.042 Identities = 20/43 (46%), Positives = 25/43 (58%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +V VLD SGSM G K+ LK AM ++ L D S+I F S Sbjct: 245 LVTVLDISGSMGGTKLALLKRAMGFVIQNLGSSDRLSVIAFSS 287 >UniRef50_Q54MG1 Cluster: Type A von Willebrand factor domain-containing protein; n=4; Dictyostelium discoideum AX4|Rep: Type A von Willebrand factor domain-containing protein - Dictyostelium discoideum AX4 Length = 831 Score = 39.5 bits (88), Expect = 0.042 Identities = 21/61 (34%), Positives = 35/61 (57%) Frame = +1 Query: 310 FVHFFAPDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 F H + D+ ++++ F++D SGSMSG +++ K A+ I+ LN F+I F S Sbjct: 299 FSHLTSDDVNQKSEFI-FLIDCSGSMSGEPIKKAKRALEIIIRSLNENCKFNIYCFGSRF 357 Query: 490 T 492 T Sbjct: 358 T 358 >UniRef50_A7SFM5 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 417 Score = 39.5 bits (88), Expect = 0.042 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +F++D SGSMSG+ + Q+KE + L L YF++I F S Sbjct: 294 IFLVDRSGSMSGKHIFQVKEMLILFLKSLPANCYFNLIGFGS 335 >UniRef50_A0E9B3 Cluster: Chromosome undetermined scaffold_84, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_84, whole genome shotgun sequence - Paramecium tetraurelia Length = 603 Score = 39.5 bits (88), Expect = 0.042 Identities = 20/52 (38%), Positives = 33/52 (63%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESI 486 D PP++ +V V+D SGSM GRK+ +K+++ ++ L P D II F ++ Sbjct: 116 DRPPID--LVCVVDVSGSMIGRKINLVKDSLRYLMKILGPEDRICIIVFTTV 165 >UniRef50_UPI00015B5333 Cluster: PREDICTED: similar to ENSANGP00000021218; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to ENSANGP00000021218 - Nasonia vitripennis Length = 1230 Score = 39.1 bits (87), Expect = 0.055 Identities = 17/46 (36%), Positives = 29/46 (63%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESI 486 K V+ ++DTSGSM+G + E + + IL+ L DY +I+ F ++ Sbjct: 233 KDVLILVDTSGSMTGMRKEIARHVVNNILDTLGNNDYVNIVKFSNV 278 >UniRef50_Q2I6M5 Cluster: VIT-vWFA-RpoN multidomain protein; n=1; uncultured delta proteobacterium DeepAnt-1F12|Rep: VIT-vWFA-RpoN multidomain protein - uncultured delta proteobacterium DeepAnt-1F12 Length = 1156 Score = 39.1 bits (87), Expect = 0.055 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = +1 Query: 334 LPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 LP L + ++ ++DTSGSMSGR + Q + + +++ L D +I+F Sbjct: 295 LPCLPRDLICLIDTSGSMSGRPLAQAQRVVAALVDRLGDDDRLELIEF 342 >UniRef50_A6TP10 Cluster: von Willebrand factor, type A; n=1; Alkaliphilus metalliredigens QYMF|Rep: von Willebrand factor, type A - Alkaliphilus metalliredigens QYMF Length = 551 Score = 39.1 bits (87), Expect = 0.055 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +1 Query: 322 FAPDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILN--ELNPGDYFSIIDFESIITV 495 F +L + V +LD SGSMSG M Q K A LN + + GD II+F S + + Sbjct: 165 FLANLQQVPLSVSLILDNSGSMSGNPMTQAKSAAKQFLNYVDFSNGDQVEIIEFNSDVYI 224 >UniRef50_A6EQD3 Cluster: von Willebrand factor type A like domain; n=1; unidentified eubacterium SCB49|Rep: von Willebrand factor type A like domain - unidentified eubacterium SCB49 Length = 733 Score = 39.1 bits (87), Expect = 0.055 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 5/71 (7%) Frame = +1 Query: 298 NDGYFVHFFAPD--LPPLN---KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYF 462 N+ +F + P + P N + +F++D SGSM+G +E K+ M +L LN D F Sbjct: 271 NEKFFAYMMEPPATVKPKNVTAREYLFIVDVSGSMNGYPLEVSKDLMRNLLCNLNADDTF 330 Query: 463 SIIDFESIITV 495 ++ F S T+ Sbjct: 331 NVQLFASSSTI 341 >UniRef50_Q233P3 Cluster: Von Willebrand factor type A domain containing protein; n=5; Tetrahymena thermophila SB210|Rep: Von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 896 Score = 39.1 bits (87), Expect = 0.055 Identities = 17/42 (40%), Positives = 27/42 (64%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +F+LD SGSMSG+ +++ EA+ L L YF+++ F S Sbjct: 315 IFLLDRSGSMSGQPIQKACEALILFLKSLPIDSYFNVVSFGS 356 >UniRef50_UPI00006CD16B Cluster: von Willebrand factor type A domain containing protein; n=2; Tetrahymena thermophila SB210|Rep: von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 730 Score = 38.7 bits (86), Expect = 0.073 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 V ++D SGSM G KME KE++ L L G ++II F S Sbjct: 267 VLIIDRSGSMYGPKMELAKESLIFFLKSLPVGSIYNIISFGS 308 >UniRef50_A2AVD6 Cluster: Novel protein; n=5; Eutheria|Rep: Novel protein - Mus musculus (Mouse) Length = 1215 Score = 38.7 bits (86), Expect = 0.073 Identities = 23/72 (31%), Positives = 36/72 (50%) Frame = +1 Query: 268 DRPKDGQILVNDGYFVHFFAPDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELN 447 D P I++N + P+ + +F++D S SMS ++ +KEAM L L Sbjct: 325 DIPHHSVIMLNFCPDLQSVQPNPRKAHGEFIFLIDRSNSMSKTNIQCIKEAMLVALKSLM 384 Query: 448 PGDYFSIIDFES 483 P +F+II F S Sbjct: 385 PACFFNIIGFGS 396 >UniRef50_Q28U54 Cluster: von Willebrand factor type A; n=1; Jannaschia sp. CCS1|Rep: von Willebrand factor type A - Jannaschia sp. (strain CCS1) Length = 686 Score = 38.7 bits (86), Expect = 0.073 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSG-RKMEQLKEAMYTILNELNPGDYFSIIDF 477 D PPLN +VF++DTSGSM+ K+ L ++ +LN L+P D +I+ + Sbjct: 323 DRPPLN--LVFLIDTSGSMNDPAKLPLLIQSFRLMLNRLSPEDEVAIVTY 370 >UniRef50_A3QDW1 Cluster: Vault protein inter-alpha-trypsin domain protein precursor; n=1; Shewanella loihica PV-4|Rep: Vault protein inter-alpha-trypsin domain protein precursor - Shewanella loihica (strain BAA-1088 / PV-4) Length = 776 Score = 38.7 bits (86), Expect = 0.073 Identities = 19/49 (38%), Positives = 29/49 (59%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 L + + V+DTSGSM+G + Q K A+ L L D F++I F+S + Sbjct: 400 LPRELTLVIDTSGSMTGDSIAQAKSAILNALAGLGSQDTFNVIAFDSSV 448 >UniRef50_A1ZFT4 Cluster: Von Willebrand factor, type A; n=1; Microscilla marina ATCC 23134|Rep: Von Willebrand factor, type A - Microscilla marina ATCC 23134 Length = 827 Score = 38.7 bits (86), Expect = 0.073 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 5/64 (7%) Frame = +1 Query: 307 YFVHFFAPDLPPLNKYV-----VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSII 471 +F+ P P N + VF++D SGSM G + K + ++ +L P D F+++ Sbjct: 304 FFLMMMQPPKAPKNSQIPPREYVFIVDVSGSMHGFPLSVSKRLLKNLIGKLRPKDKFNVM 363 Query: 472 DFES 483 FES Sbjct: 364 LFES 367 >UniRef50_Q23JA0 Cluster: Von Willebrand factor type A domain containing protein; n=2; Tetrahymena thermophila SB210|Rep: Von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 1049 Score = 38.7 bits (86), Expect = 0.073 Identities = 18/42 (42%), Positives = 26/42 (61%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +F+LD SGSMSG+ + + EA+ L L YF++I F S Sbjct: 314 IFLLDRSGSMSGQPIRRACEALTLFLKSLPNDSYFNVISFGS 355 >UniRef50_A0DZ93 Cluster: Chromosome undetermined scaffold_7, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_7, whole genome shotgun sequence - Paramecium tetraurelia Length = 522 Score = 38.7 bits (86), Expect = 0.073 Identities = 16/42 (38%), Positives = 28/42 (66%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFE 480 ++ ++D SGSMSG KM +K+++ +L L P D +I+F+ Sbjct: 114 LICLIDHSGSMSGEKMHLVKKSLKHLLKMLQPNDRLCLIEFD 155 >UniRef50_UPI0000EBE040 Cluster: PREDICTED: similar to voltage-gated calcium channel alpha(2)delta-3 subunit; n=1; Bos taurus|Rep: PREDICTED: similar to voltage-gated calcium channel alpha(2)delta-3 subunit - Bos taurus Length = 897 Score = 38.3 bits (85), Expect = 0.096 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 K VV ++D SGSM G +M K+ + +IL+ L D+F+II + Sbjct: 821 KDVVILVDVSGSMKGLRMTIAKQTVSSILDTLGDDDFFNIIAY 863 >UniRef50_UPI00006CAF43 Cluster: von Willebrand factor type A domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 631 Score = 38.3 bits (85), Expect = 0.096 Identities = 15/44 (34%), Positives = 30/44 (68%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESI 486 ++ V+D SGSMSG+K + +++++ +L +N D +I F+S+ Sbjct: 145 LICVIDDSGSMSGKKAQLVRKSLKYLLKIMNENDRICLISFDSV 188 >UniRef50_A7RNW3 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 798 Score = 38.3 bits (85), Expect = 0.096 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +FV+D SGSMSG +++ + L L G YF+I+ F S Sbjct: 290 IFVVDRSGSMSGSRIKDAARTLQLFLKSLPDGCYFNIVGFGS 331 >UniRef50_Q5V2Z1 Cluster: Von Willebrand factor type A like metal binding protein; n=1; Haloarcula marismortui|Rep: Von Willebrand factor type A like metal binding protein - Haloarcula marismortui (Halobacterium marismortui) Length = 394 Score = 38.3 bits (85), Expect = 0.096 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = +1 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 P + + +D SGSM+G +EQ + + L+ DY SII F++ +T Sbjct: 35 PPTRQIALCIDASGSMAGNDIEQARAGAEWVFGLLDEDDYVSIIAFDNEVT 85 >UniRef50_UPI0000D577A5 Cluster: PREDICTED: similar to CG4587-PA; n=3; Endopterygota|Rep: PREDICTED: similar to CG4587-PA - Tribolium castaneum Length = 1200 Score = 37.9 bits (84), Expect = 0.13 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESI 486 K +V ++D SGSMSG K + +ILN L D+ ++ F I Sbjct: 262 KDIVILIDNSGSMSGHKSNLARATTESILNTLGDNDFVNVFKFSDI 307 >UniRef50_Q7NTS8 Cluster: Putative uncharacterized protein; n=1; Chromobacterium violaceum|Rep: Putative uncharacterized protein - Chromobacterium violaceum Length = 177 Score = 37.9 bits (84), Expect = 0.13 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 2/73 (2%) Frame = +1 Query: 16 TANISELRVPEIRTGNEVD-ATKDDAQMSNVIIQ-REGTSAVITFSPDLEEQKRLMHVYA 189 T++ + +P++ + E D A K D Q++ V+ R G SA S E+QKRL+++ Sbjct: 106 TSSAGQTGLPDLMSSEEADRAAKSDPQVAAVMRAIRSGHSAKSASSAPAEDQKRLLNIIK 165 Query: 190 EKSKESATGENAG 228 E +K S G N G Sbjct: 166 ELNK-SDPGRNPG 177 >UniRef50_A0PNR0 Cluster: Putative uncharacterized protein; n=1; Mycobacterium ulcerans Agy99|Rep: Putative uncharacterized protein - Mycobacterium ulcerans (strain Agy99) Length = 733 Score = 37.9 bits (84), Expect = 0.13 Identities = 20/45 (44%), Positives = 27/45 (60%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 VV VLD SGSM G KM + A I++ L+ GD F ++ F+ I Sbjct: 271 VVVVLDRSGSMGGWKMVAARRAAGRIVDMLDAGDRFCVLAFDDRI 315 >UniRef50_A7R324 Cluster: Chromosome chr7 scaffold_476, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome chr7 scaffold_476, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 664 Score = 37.9 bits (84), Expect = 0.13 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +V VLD G M+G K++ +K AM +++ L+ D SI+ F + Sbjct: 288 LVTVLDVGGGMTGAKLQMMKRAMRLVISSLSSTDRLSIVAFSA 330 >UniRef50_Q23FU3 Cluster: Von Willebrand factor type A domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 755 Score = 37.9 bits (84), Expect = 0.13 Identities = 14/43 (32%), Positives = 29/43 (67%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 ++ ++D SGSM+G+K + +++++ +L L GD S++ F S Sbjct: 50 IICLIDNSGSMAGKKAQLVRKSLKYLLKILEKGDQISLVSFSS 92 >UniRef50_Q8YW34 Cluster: All1782 protein; n=4; Cyanobacteria|Rep: All1782 protein - Anabaena sp. (strain PCC 7120) Length = 615 Score = 37.5 bits (83), Expect = 0.17 Identities = 15/54 (27%), Positives = 31/54 (57%) Frame = +1 Query: 328 PDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 P+ P N + V+D SGSM+G + +A +++++L P D S++ ++ + Sbjct: 32 PESPRRNLNLSLVIDRSGSMAGAALHHALKAAESVVDQLEPKDILSVVVYDDAV 85 >UniRef50_Q6ZED8 Cluster: Slr7060 protein; n=1; Synechocystis sp. PCC 6803|Rep: Slr7060 protein - Synechocystis sp. (strain PCC 6803) Length = 588 Score = 37.5 bits (83), Expect = 0.17 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%) Frame = +1 Query: 325 APDLPPLNKYVVFVLDTSGSMSGR-KMEQLKEAMYTILNELNPGDYFSIIDFE 480 A D P + + FV+D SGSM G K+ ++A+ +++L+PGD+ S+ F+ Sbjct: 36 AMDQPRPSLNLGFVIDRSGSMEGHNKITYARQAVCYAIDQLSPGDHLSVTIFD 88 >UniRef50_Q7PM11 Cluster: ENSANGP00000004592; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000004592 - Anopheles gambiae str. PEST Length = 1105 Score = 37.5 bits (83), Expect = 0.17 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 K V+ +LD+SGSMSG++ + IL+ L D+F++I F Sbjct: 153 KDVIILLDSSGSMSGKEYQLAVATASAILDTLGDDDFFNLISF 195 >UniRef50_Q7K0H4 Cluster: SD07723p; n=5; Diptera|Rep: SD07723p - Drosophila melanogaster (Fruit fly) Length = 1218 Score = 37.5 bits (83), Expect = 0.17 Identities = 16/48 (33%), Positives = 30/48 (62%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 K +V ++D SGSM G++++ K + TIL+ L D+ +I F+ ++ Sbjct: 266 KDIVILMDGSGSMLGQRLDIAKHVVNTILDTLGTNDFVNIFTFDKEVS 313 >UniRef50_Q23J98 Cluster: Von Willebrand factor type A domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 1633 Score = 37.5 bits (83), Expect = 0.17 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +F+LD SGSM G+ + + EA+ L L YF++I F S Sbjct: 1049 IFILDRSGSMRGQPIRRACEAIILFLKSLPNDSYFNVISFGS 1090 >UniRef50_A7LBJ7 Cluster: Voltage-gated calcium channel alpha2-delta subunit 1; n=1; Anopheles gambiae|Rep: Voltage-gated calcium channel alpha2-delta subunit 1 - Anopheles gambiae (African malaria mosquito) Length = 1256 Score = 37.5 bits (83), Expect = 0.17 Identities = 17/43 (39%), Positives = 27/43 (62%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 K V+ +LD+SGSMSG++ + IL+ L D+F++I F Sbjct: 268 KDVIILLDSSGSMSGKEYQLAVATASAILDTLGDDDFFNLISF 310 >UniRef50_A2E0T6 Cluster: von Willebrand factor type A domain containing protein; n=1; Trichomonas vaginalis G3|Rep: von Willebrand factor type A domain containing protein - Trichomonas vaginalis G3 Length = 753 Score = 37.5 bits (83), Expect = 0.17 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 4/73 (5%) Frame = +1 Query: 271 RPKDGQILVN-DGYF---VHFFAPDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILN 438 + KD I ++ DGY + F N F++D SGSM G +++ K + +L+ Sbjct: 212 KDKDKSIAISSDGYISISTYTFFEGKVQANTEFYFIIDCSGSMYGSRIKNAKSCLNVLLH 271 Query: 439 ELNPGDYFSIIDF 477 L G FSII F Sbjct: 272 SLPIGCRFSIIKF 284 >UniRef50_A6QUR7 Cluster: Predicted protein; n=2; Onygenales|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 389 Score = 37.5 bits (83), Expect = 0.17 Identities = 20/51 (39%), Positives = 30/51 (58%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 ++P N +VF++D SGSM G K++ L+ A+ L L G F+I F S Sbjct: 285 NIPNNNPEIVFIIDRSGSMGG-KIQTLQTALRVFLKSLPVGVKFNICSFGS 334 >UniRef50_UPI0000D5654E Cluster: PREDICTED: similar to CG12295-PB; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG12295-PB - Tribolium castaneum Length = 1023 Score = 37.1 bits (82), Expect = 0.22 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 K VV ++D SGSM+G + E + ++ IL+ L DY +I F + Sbjct: 73 KDVVILVDRSGSMTGMRREIARHVVHNILDTLGNNDYVNIFTFSN 117 >UniRef50_Q5KWL5 Cluster: Putative uncharacterized protein GK2636; n=1; Geobacillus kaustophilus|Rep: Putative uncharacterized protein GK2636 - Geobacillus kaustophilus Length = 960 Score = 37.1 bits (82), Expect = 0.22 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 4/51 (7%) Frame = +1 Query: 337 PPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILN----ELNPGDYFSIIDF 477 PP++ VVFV+D SGSM+ K++ K A+ +N N D F++I F Sbjct: 79 PPID--VVFVMDVSGSMTAMKLQSAKSALQAAVNYFKSNYNQNDRFALIPF 127 >UniRef50_Q2BJH8 Cluster: Uncharacterized protein containing a von Willebrand factor type A(VWA) domain; n=3; Oceanospirillales|Rep: Uncharacterized protein containing a von Willebrand factor type A(VWA) domain - Neptuniibacter caesariensis Length = 707 Score = 37.1 bits (82), Expect = 0.22 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 331 DLPPLN--KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 DLP N + VFVLD SGSM G K L E + L+ L+P D F I+ F + Sbjct: 304 DLPAFNQGRDWVFVLDISGSMKG-KFAALVEGVREGLSNLSPNDRFRIVLFNN 355 >UniRef50_A6FSG0 Cluster: Putative uncharacterized protein; n=1; Roseobacter sp. AzwK-3b|Rep: Putative uncharacterized protein - Roseobacter sp. AzwK-3b Length = 444 Score = 37.1 bits (82), Expect = 0.22 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = +1 Query: 337 PPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 PPLN + VLD S SM G+ + + K A I+ L P D +I+ F++ V Sbjct: 41 PPLN--LALVLDRSSSMRGQPLHEAKRAADQIVAGLRPSDRLAIVAFDNATEV 91 >UniRef50_A6DK65 Cluster: Cardiolipin synthetase; n=1; Lentisphaera araneosa HTCC2155|Rep: Cardiolipin synthetase - Lentisphaera araneosa HTCC2155 Length = 607 Score = 37.1 bits (82), Expect = 0.22 Identities = 21/70 (30%), Positives = 39/70 (55%) Frame = +1 Query: 292 LVNDGYFVHFFAPDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSII 471 ++N+G +F++ LP + +V+DTS SM G ++E L E M + +L ++I+ Sbjct: 417 VMNEGPNGYFYS--LPIYSDRFCYVVDTSASMRGPRIESLDENMAMSVEQLLNKSKYNIV 474 Query: 472 DFESIITVHE 501 DF + + E Sbjct: 475 DFGGDVEIME 484 >UniRef50_Q7Z3S7 Cluster: Voltage-dependent calcium channel subunit alpha-2/delta-4 precursor (Voltage-gated calcium channel subunit alpha-2/delta-4) [Contains: Voltage-dependent calcium channel subunit alpha-2-4; Voltage-dependent calcium channel subunit delta-4]; n=21; Euteleostomi|Rep: Voltage-dependent calcium channel subunit alpha-2/delta-4 precursor (Voltage-gated calcium channel subunit alpha-2/delta-4) [Contains: Voltage-dependent calcium channel subunit alpha-2-4; Voltage-dependent calcium channel subunit delta-4] - Homo sapiens (Human) Length = 1137 Score = 37.1 bits (82), Expect = 0.22 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 K +V ++D SGSM G +M K + TIL+ L D+ +II + + Sbjct: 290 KDIVILVDVSGSMKGLRMTIAKHTITTILDTLGENDFVNIIAYNDYV 336 >UniRef50_Q8IZS8 Cluster: Voltage-dependent calcium channel subunit alpha-2/delta-3 precursor (Voltage-gated calcium channel subunit alpha-2/delta-3) [Contains: Voltage-dependent calcium channel subunit alpha-2-3; Voltage-dependent calcium channel subunit delta-3]; n=48; Euteleostomi|Rep: Voltage-dependent calcium channel subunit alpha-2/delta-3 precursor (Voltage-gated calcium channel subunit alpha-2/delta-3) [Contains: Voltage-dependent calcium channel subunit alpha-2-3; Voltage-dependent calcium channel subunit delta-3] - Homo sapiens (Human) Length = 1091 Score = 37.1 bits (82), Expect = 0.22 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 K VV ++D SGSM G ++ K+ + +IL+ L D+F+II + Sbjct: 255 KDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAY 297 >UniRef50_UPI00015B5332 Cluster: PREDICTED: similar to ENSANGP00000020925; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to ENSANGP00000020925 - Nasonia vitripennis Length = 2053 Score = 36.7 bits (81), Expect = 0.29 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 3/85 (3%) Frame = +1 Query: 232 GVLGQF-VVQYDVDRPKDGQILVNDGYF--VHFFAPDLPPLNKYVVFVLDTSGSMSGRKM 402 GVL Q+ +++ V KDG+ + D Y V + + +K +V ++D SGSM+G Sbjct: 1067 GVLRQYPAMRWPVSLKKDGKE-ITDTYDCRVRSWFIEASTCSKDMVILVDNSGSMTGMSN 1125 Query: 403 EQLKEAMYTILNELNPGDYFSIIDF 477 K + TI++ L+ D+ ++ +F Sbjct: 1126 AIAKTTVSTIMSTLSNNDFVAVFNF 1150 >UniRef50_A7C4W6 Cluster: von Willebrand factor, type A; n=1; Beggiatoa sp. PS|Rep: von Willebrand factor, type A - Beggiatoa sp. PS Length = 305 Score = 36.7 bits (81), Expect = 0.29 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 +V VLDTSG M G K+ + +L + DYFS++ F Sbjct: 129 IVLVLDTSGGMRGEKILHARTMALQLLEIVKEADYFSLLSF 169 >UniRef50_A5UX14 Cluster: von Willebrand factor, type A precursor; n=5; Chloroflexi (class)|Rep: von Willebrand factor, type A precursor - Roseiflexus sp. RS-1 Length = 543 Score = 36.7 bits (81), Expect = 0.29 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 ++ V+D SGSM G K+E K + T L+ + P D +I F + Sbjct: 370 ILLVVDVSGSMEGEKLEAAKSGLGTFLSRILPEDRVGLIVFST 412 >UniRef50_A7RV93 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1118 Score = 36.7 bits (81), Expect = 0.29 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSII 471 K +V +LD S SM G+++ KE T+LN L D+ ++I Sbjct: 240 KDIVIILDCSLSMKGKRLRMAKEIAKTVLNTLTKQDFVNVI 280 >UniRef50_A2E6Y7 Cluster: von Willebrand factor type A domain containing protein; n=3; Trichomonas vaginalis G3|Rep: von Willebrand factor type A domain containing protein - Trichomonas vaginalis G3 Length = 720 Score = 36.7 bits (81), Expect = 0.29 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +1 Query: 361 FVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 F++D SGSMSG ++E K + +++ L G FSII F Sbjct: 245 FIIDCSGSMSGSRIENAKFCLNILIHSLPIGCRFSIIQF 283 >UniRef50_Q4X0P4 Cluster: Von Willebrand domain protein; n=3; Trichocomaceae|Rep: Von Willebrand domain protein - Aspergillus fumigatus (Sartorya fumigata) Length = 946 Score = 36.7 bits (81), Expect = 0.29 Identities = 20/50 (40%), Positives = 28/50 (56%) Frame = +1 Query: 334 LPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 L P+ ++FV+D SGSM K++ LK A+ L L G F+I F S Sbjct: 288 LEPIKPEIIFVIDRSGSMMD-KIDTLKSALRVFLKSLPVGVCFNICSFGS 336 >UniRef50_Q55874 Cluster: Uncharacterized protein sll0103; n=6; Cyanobacteria|Rep: Uncharacterized protein sll0103 - Synechocystis sp. (strain PCC 6803) Length = 420 Score = 36.7 bits (81), Expect = 0.29 Identities = 19/47 (40%), Positives = 28/47 (59%) Frame = +1 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFE 480 PLN + VLD SGSM G+ +E +K A +++ L D S+I F+ Sbjct: 41 PLN--LCLVLDHSGSMDGQPLETVKSAALGLIDRLEEDDRLSVIAFD 85 >UniRef50_UPI0000F1F488 Cluster: PREDICTED: similar to voltage-gated calcium channel alpha(2)delta-3 subunit; n=3; Danio rerio|Rep: PREDICTED: similar to voltage-gated calcium channel alpha(2)delta-3 subunit - Danio rerio Length = 1016 Score = 36.3 bits (80), Expect = 0.39 Identities = 17/47 (36%), Positives = 29/47 (61%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 K VV ++D SGSM G ++ ++ + +IL+ L D+F+II + I Sbjct: 250 KDVVILVDVSGSMKGLRLTIARQTVASILDTLGDDDFFNIIAYNQEI 296 >UniRef50_UPI00006CC819 Cluster: von Willebrand factor type A domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 930 Score = 36.3 bits (80), Expect = 0.39 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 +F+LD SGSMSG+ ++ EA+ + L YF+I F Sbjct: 328 IFLLDRSGSMSGQSIQNAIEALILFIKSLPLDSYFNIYSF 367 >UniRef50_UPI000065EB99 Cluster: voltage-gated calcium channel alpha(2)delta-4 subunit; n=2; Takifugu rubripes|Rep: voltage-gated calcium channel alpha(2)delta-4 subunit - Takifugu rubripes Length = 1030 Score = 36.3 bits (80), Expect = 0.39 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSII 471 K ++ ++D SGSM G KM K + TIL+ L D+ +II Sbjct: 138 KDIIIMVDISGSMKGLKMTIAKHTINTILDTLGENDFVNII 178 >UniRef50_Q6LP90 Cluster: Putative uncharacterized protein; n=3; Gammaproteobacteria|Rep: Putative uncharacterized protein - Photobacterium profundum (Photobacterium sp. (strain SS9)) Length = 494 Score = 36.3 bits (80), Expect = 0.39 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNEL 444 +VFV D SGSM G K+ LK+A+ I NE+ Sbjct: 156 IVFVSDFSGSMKGNKIRALKDAIQAIANEI 185 >UniRef50_Q1DFU7 Cluster: Von Willebrand factor type A domain protein; n=2; Cystobacterineae|Rep: Von Willebrand factor type A domain protein - Myxococcus xanthus (strain DK 1622) Length = 422 Score = 36.3 bits (80), Expect = 0.39 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 + VLD SGSM+G+K+ + A ++ L P D + ID+ + + V Sbjct: 49 LALVLDRSGSMNGQKLADARRAATELVQRLKPEDRLAFIDYGTDVRV 95 >UniRef50_A1VI76 Cluster: Vault protein inter-alpha-trypsin domain protein precursor; n=2; Burkholderiales|Rep: Vault protein inter-alpha-trypsin domain protein precursor - Polaromonas naphthalenivorans (strain CJ2) Length = 701 Score = 36.3 bits (80), Expect = 0.39 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 +FV+D SGSM G ++ K M ++ +L P D F+++ F Sbjct: 329 IFVVDISGSMHGFPLDTAKTLMRELIGKLRPSDTFNVLLF 368 >UniRef50_A2DPQ9 Cluster: von Willebrand factor type A domain containing protein; n=1; Trichomonas vaginalis G3|Rep: von Willebrand factor type A domain containing protein - Trichomonas vaginalis G3 Length = 694 Score = 36.3 bits (80), Expect = 0.39 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 349 KYVVFVLDTSGSMS-GRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 K +VF+LD SGSM+ ++E +AM L+ L PG F I+ F S Sbjct: 237 KSIVFLLDCSGSMTIDNRIENAIKAMDLFLHSLEPGVKFEIVRFGS 282 >UniRef50_UPI00006CF2E6 Cluster: hypothetical protein TTHERM_00059510; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00059510 - Tetrahymena thermophila SB210 Length = 1882 Score = 35.9 bits (79), Expect = 0.51 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +1 Query: 268 DRPKDGQILVNDGYF-VHFFAPDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTI 432 DR ++ + +D Y+ ++F +PP N Y F + +GS SG ++KE Y I Sbjct: 135 DRTQNSYLKESDYYYNFNYFTTIIPPNNAYTKFSIVDNGSASGSSYLKVKEIQYNI 190 >UniRef50_Q4RW93 Cluster: Chromosome 9 SCAF14991, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 9 SCAF14991, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 766 Score = 35.9 bits (79), Expect = 0.51 Identities = 16/43 (37%), Positives = 28/43 (65%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 K VV ++D SGSM G ++ ++ + +IL+ L D+F+II + Sbjct: 195 KDVVILVDVSGSMKGLRLTIARQTVSSILDTLGDDDFFNIIAY 237 >UniRef50_Q7UNM0 Cluster: Putative uncharacterized protein; n=1; Pirellula sp.|Rep: Putative uncharacterized protein - Rhodopirellula baltica Length = 900 Score = 35.9 bits (79), Expect = 0.51 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFE 480 ++ V+D SGSM G+K+E K+A + L P D +I F+ Sbjct: 465 MMLVIDKSGSMGGQKIELAKDAAQAAVELLGPKDAIGVIAFD 506 >UniRef50_Q0LNA4 Cluster: Von Willebrand factor, type A; n=1; Herpetosiphon aurantiacus ATCC 23779|Rep: Von Willebrand factor, type A - Herpetosiphon aurantiacus ATCC 23779 Length = 610 Score = 35.9 bits (79), Expect = 0.51 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +1 Query: 355 VVFVLDTSGSMS-GRKMEQLKEAMYTILNELNPGDYFSIIDF 477 + FV+DTSGSM+ ++E +K A+ + +L P D +I+ F Sbjct: 268 LTFVIDTSGSMAQDNRLEMVKNALIYLAGQLEPDDSLAIVAF 309 >UniRef50_Q093T2 Cluster: Von Willebrand factor type A domain protein; n=3; Cystobacterineae|Rep: Von Willebrand factor type A domain protein - Stigmatella aurantiaca DW4/3-1 Length = 476 Score = 35.9 bits (79), Expect = 0.51 Identities = 18/48 (37%), Positives = 29/48 (60%) Frame = +1 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 P+N + ++D SGSMSG K+EQ K+A ++ L D +I+ + S Sbjct: 94 PVN--LALIIDRSGSMSGYKLEQAKQAARHLVTLLKDDDRLAIVHYGS 139 >UniRef50_A6GC99 Cluster: Putative uncharacterized protein; n=1; Plesiocystis pacifica SIR-1|Rep: Putative uncharacterized protein - Plesiocystis pacifica SIR-1 Length = 546 Score = 35.9 bits (79), Expect = 0.51 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 + VLD SGSM G K+ K+A ++N L+ D ++I ++ +T Sbjct: 133 LAIVLDRSGSMGGDKLRFAKQAGLDLVNRLDEQDRVTLISYDDTVT 178 >UniRef50_A5UUC9 Cluster: von Willebrand factor, type A; n=5; Chloroflexi (class)|Rep: von Willebrand factor, type A - Roseiflexus sp. RS-1 Length = 420 Score = 35.9 bits (79), Expect = 0.51 Identities = 17/47 (36%), Positives = 29/47 (61%) Frame = +1 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFE 480 P+N V FV+D SGSM G K+++++ A + L+ D S++ F+ Sbjct: 43 PVN--VCFVIDRSGSMKGEKIDRVRRATIRAIEMLDAQDVVSVVIFD 87 >UniRef50_A0V8E6 Cluster: Von Willebrand factor, type A; n=1; Delftia acidovorans SPH-1|Rep: Von Willebrand factor, type A - Delftia acidovorans SPH-1 Length = 244 Score = 35.9 bits (79), Expect = 0.51 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 6/67 (8%) Frame = +1 Query: 319 FFAPDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGD------YFSIIDFE 480 F AP PL VV +LD SGSMSG K+ + +A+ +L+ + + + +II F Sbjct: 11 FTAPKAKPLP--VVLLLDVSGSMSGEKIRNVNDAVRDMLDTFSDTENGETEIHVAIITFG 68 Query: 481 SIITVHE 501 S + +H+ Sbjct: 69 SQVALHQ 75 >UniRef50_A0PRV7 Cluster: Conserved membrane protein; n=1; Mycobacterium ulcerans Agy99|Rep: Conserved membrane protein - Mycobacterium ulcerans (strain Agy99) Length = 981 Score = 35.9 bits (79), Expect = 0.51 Identities = 17/47 (36%), Positives = 28/47 (59%) Frame = +1 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFE 480 P +++V VLD S SM+G KM + A I++ L D F+++ F+ Sbjct: 294 PRPRHLVLVLDRSRSMAGWKMTAARRAASRIVDALTSDDRFAVLTFD 340 >UniRef50_A0LHW4 Cluster: Vault protein inter-alpha-trypsin domain protein; n=3; Deltaproteobacteria|Rep: Vault protein inter-alpha-trypsin domain protein - Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) Length = 812 Score = 35.9 bits (79), Expect = 0.51 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +1 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 P +Y+ F++D SGSM G +E K + ++ L P D F+++ F TV Sbjct: 330 PAREYI-FIVDVSGSMHGFPLEISKRLLTDLIGGLKPTDCFNVMLFSGDSTV 380 >UniRef50_A7EVE2 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 345 Score = 35.9 bits (79), Expect = 0.51 Identities = 21/50 (42%), Positives = 27/50 (54%) Frame = +1 Query: 334 LPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 LP N +VFV+D SGSM M L+ AM L L G +F++ F S Sbjct: 85 LPAHNPEIVFVVDRSGSMRS-SMSILRSAMSVSLKSLPSGIHFNLCSFGS 133 >UniRef50_Q4J9H3 Cluster: Conserved protein; n=4; Sulfolobaceae|Rep: Conserved protein - Sulfolobus acidocaldarius Length = 380 Score = 35.9 bits (79), Expect = 0.51 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = +1 Query: 352 YVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 + + +LDTSGSM G K+E K+ +L+ + G+ S + F + + + Sbjct: 39 HYIILLDTSGSMYGVKIETAKQGAMELLSRIPEGNKISFLTFSNNVNI 86 >UniRef50_Q4RXK6 Cluster: Chromosome 11 SCAF14979, whole genome shotgun sequence; n=4; Clupeocephala|Rep: Chromosome 11 SCAF14979, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1156 Score = 35.5 bits (78), Expect = 0.68 Identities = 16/41 (39%), Positives = 27/41 (65%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSII 471 K VV ++D SGSM G ++ ++ + +IL+ L D+F+II Sbjct: 175 KDVVILVDVSGSMKGLRLTIARQTVSSILDTLGDDDFFNII 215 >UniRef50_Q8E999 Cluster: Von Willebrand factor type A domain protein; n=11; Gammaproteobacteria|Rep: Von Willebrand factor type A domain protein - Shewanella oneidensis Length = 451 Score = 35.5 bits (78), Expect = 0.68 Identities = 18/46 (39%), Positives = 28/46 (60%) Frame = +1 Query: 340 PLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 P+N + V+D SGSMSG ++E+ +EA +N L D S+I + Sbjct: 70 PIN--LSLVIDRSGSMSGDRIEKAREAAIMAINMLKDDDIVSVIAY 113 >UniRef50_Q1CVN5 Cluster: Von Willebrand factor type A domain protein; n=2; Cystobacterineae|Rep: Von Willebrand factor type A domain protein - Myxococcus xanthus (strain DK 1622) Length = 700 Score = 35.5 bits (78), Expect = 0.68 Identities = 17/45 (37%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +1 Query: 352 YVVFVLDTSGSMS-GRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 ++VFV+D SGSM+ ++ +K A++ ++NEL+ D SI+ + S Sbjct: 335 HLVFVIDVSGSMNLENRLGLVKRALHLLVNELDERDQVSIVVYGS 379 >UniRef50_A3ZR58 Cluster: Putative uncharacterized protein; n=1; Blastopirellula marina DSM 3645|Rep: Putative uncharacterized protein - Blastopirellula marina DSM 3645 Length = 1032 Score = 35.5 bits (78), Expect = 0.68 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 ++ VLD SGSM G KM+ + A + + D+ +I F+S Sbjct: 459 LMLVLDKSGSMQGEKMQMTQGAALAAIRAMGAADFAGVIGFDS 501 >UniRef50_A3Q9N7 Cluster: Putative outer membrane adhesin like proteiin; n=1; Shewanella loihica PV-4|Rep: Putative outer membrane adhesin like proteiin - Shewanella loihica (strain BAA-1088 / PV-4) Length = 4836 Score = 35.5 bits (78), Expect = 0.68 Identities = 23/94 (24%), Positives = 40/94 (42%), Gaps = 6/94 (6%) Frame = +1 Query: 181 VYAEKSKESATGENAGEGVLGQFVVQYDVDRPKDGQILVNDGYFVHFFAPDLPPL----- 345 + A ++S + + + L + Y D DG ++N G D + Sbjct: 4222 IKASSVEQSNSDSASSQTTLDVSLRNYHYDNGTDGDNVINGGEDNDVIVSDTTGIQVVQG 4281 Query: 346 -NKYVVFVLDTSGSMSGRKMEQLKEAMYTILNEL 444 N V F+LD+SGSM ++E K+ + + N L Sbjct: 4282 ENYNVAFILDSSGSMGSNRIESAKDQLLQVFNTL 4315 >UniRef50_Q9U7P4 Cluster: Putative uncharacterized protein; n=1; Eufolliculina uhligi|Rep: Putative uncharacterized protein - Eufolliculina uhligi Length = 494 Score = 35.5 bits (78), Expect = 0.68 Identities = 15/46 (32%), Positives = 27/46 (58%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 +V V+D SGSM G K++ ++ + ++ L+P D +I F + T Sbjct: 91 IVCVIDVSGSMQGEKIQLVQTTLNFMVERLSPADRICLISFSNDAT 136 >UniRef50_Q22ST4 Cluster: Von Willebrand factor type A domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Von Willebrand factor type A domain containing protein - Tetrahymena thermophila SB210 Length = 648 Score = 35.5 bits (78), Expect = 0.68 Identities = 16/41 (39%), Positives = 26/41 (63%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 +V V+D SGSM G K++ +KE + I+N ++ D I+ F Sbjct: 224 LVVVIDKSGSMEGEKIQLVKETLVKIINLMSSMDRICIVCF 264 >UniRef50_UPI0000DC2245 Cluster: integrin, alpha D; n=4; Eutheria|Rep: integrin, alpha D - Rattus norvegicus Length = 1199 Score = 35.1 bits (77), Expect = 0.90 Identities = 15/58 (25%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +1 Query: 328 PDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNEL-NPGDYFSIIDFESIITVH 498 P+ P + F++D SGS++ R Q+K+ + ++ E + FS++ + +I+ H Sbjct: 149 PECPRQEMDIAFLIDGSGSINQRDFAQMKDFVKALMGEFASTSTLFSLMQYSNILKTH 206 >UniRef50_Q8D5V0 Cluster: Uncharacterized protein containing a von Willebrand factor type A (VWA) domain; n=2; Vibrio vulnificus|Rep: Uncharacterized protein containing a von Willebrand factor type A (VWA) domain - Vibrio vulnificus Length = 688 Score = 35.1 bits (77), Expect = 0.90 Identities = 21/42 (50%), Positives = 26/42 (61%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 VFVLD SGSMSG K L E + L +L GD F I+ F++ Sbjct: 312 VFVLDKSGSMSG-KHATLTEGVKRGLGKLPSGDRFRILMFDN 352 >UniRef50_A6M139 Cluster: von Willebrand factor, type A precursor; n=1; Clostridium beijerinckii NCIMB 8052|Rep: von Willebrand factor, type A precursor - Clostridium beijerinckii NCIMB 8052 Length = 962 Score = 35.1 bits (77), Expect = 0.90 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 7/91 (7%) Frame = +1 Query: 244 QFVVQYDVDRPKDG----QILVNDGYFVHFFAPDLPPLNKYVVFVLDTSGSMSGR-KMEQ 408 QF V D PK+ +I +N F +PP K +V VLD+SGSM+ K+ Sbjct: 43 QFTVTIDSYTPKNPKLGEEITINGTIHPQPFKISIPP--KEIVLVLDSSGSMADNYKLTN 100 Query: 409 LKEAMYTILNELN--PGDYFSIIDFESIITV 495 LK+A + +++ +I+DF++ T+ Sbjct: 101 LKKAATDFITKMSTVKNLKIAIVDFDTQATI 131 >UniRef50_A2E4Q6 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 365 Score = 35.1 bits (77), Expect = 0.90 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = +1 Query: 346 NKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITVH 498 N F++D SGSM+G ++ + KEA+ L L G ++I F S H Sbjct: 260 NSEFYFLVDQSGSMAGSRITKAKEALKFFLQSLPVGCRYAIYGFGSNYVTH 310 >UniRef50_Q8TYU9 Cluster: Mg-chelatase subunit ChlI and Chld; n=1; Methanopyrus kandleri|Rep: Mg-chelatase subunit ChlI and Chld - Methanopyrus kandleri Length = 818 Score = 35.1 bits (77), Expect = 0.90 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILN-ELNPGDYFSIIDFES 483 +V+V+DTSGSMSG +++ K A + + + GD I+ F + Sbjct: 638 IVYVIDTSGSMSGDRIDAAKRAAIALAHFSVKAGDRVGIVGFNT 681 >UniRef50_A4YGI9 Cluster: Von Willebrand factor, type A; n=1; Metallosphaera sedula DSM 5348|Rep: Von Willebrand factor, type A - Metallosphaera sedula DSM 5348 Length = 363 Score = 35.1 bits (77), Expect = 0.90 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +1 Query: 346 NKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFE---SIITVHE 501 N + V ++D S SM G K+E KE +++ L FS++ F SII HE Sbjct: 16 NLHYVILIDRSYSMKGEKLEMAKEGARLLVDNLPKDSRFSLLAFNEKVSIIKEHE 70 >UniRef50_UPI00006CBAAA Cluster: hypothetical protein TTHERM_00502400; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00502400 - Tetrahymena thermophila SB210 Length = 323 Score = 34.7 bits (76), Expect = 1.2 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 VVF LD SGSM+G++ Q+ + + L D+ S+I F I + Sbjct: 188 VVFNLDISGSMAGQRWRQVCNCVSRFTDSLTENDFASVILFNDSIRI 234 >UniRef50_A5UXM2 Cluster: von Willebrand factor, type A; n=1; Roseiflexus sp. RS-1|Rep: von Willebrand factor, type A - Roseiflexus sp. RS-1 Length = 774 Score = 34.7 bits (76), Expect = 1.2 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +1 Query: 346 NKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 N V+ +D SGSM+G KM +EA ++ + GD I+ F Sbjct: 155 NVSVILTIDRSGSMAGNKMVAAREASRQFVDLMQAGDGIGIVGF 198 >UniRef50_A1VWQ7 Cluster: Von Willebrand factor, type A; n=3; Proteobacteria|Rep: Von Willebrand factor, type A - Polaromonas naphthalenivorans (strain CJ2) Length = 212 Score = 34.7 bits (76), Expect = 1.2 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 V ++DTSGSMSG +E +K + +++ L Y F SIIT Sbjct: 6 VYLLVDTSGSMSGEPIEAVKNGVQVLVSTLRQDPYALETAFLSIIT 51 >UniRef50_Q555M1 Cluster: Putative uncharacterized protein; n=2; Dictyostelium discoideum|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 145 Score = 34.7 bits (76), Expect = 1.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 165 KTIDARICGEIERICYRGKCGRRCFRSI 248 K D + GE ++ CYR CG++CFR I Sbjct: 116 KDSDCKAYGENQKCCYRIGCGKKCFRGI 143 >UniRef50_A0C946 Cluster: Chromosome undetermined scaffold_16, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_16, whole genome shotgun sequence - Paramecium tetraurelia Length = 1279 Score = 34.7 bits (76), Expect = 1.2 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 5/72 (6%) Frame = +1 Query: 277 KDGQILVNDGYF-VHFFAPDLPPLNK--YVVFVLDTSGSMSGRKMEQLKEAMYTILNELN 447 K G+++ N Y FF +L N+ + + V+D SGSM+G+K + L EA+ EL Sbjct: 1073 KVGKVICN--YLNCRFFQKELEQWNQSHHFILVIDESGSMAGQKWKILMEAIQQCFIELR 1130 Query: 448 --PGDYFSIIDF 477 P + S+I F Sbjct: 1131 KYPNNRISLIQF 1142 >UniRef50_Q2FNC6 Cluster: Von Willebrand factor, type A; n=1; Methanospirillum hungatei JF-1|Rep: Von Willebrand factor, type A - Methanospirillum hungatei (strain JF-1 / DSM 864) Length = 233 Score = 34.7 bits (76), Expect = 1.2 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGD 456 V VLDTS SMSG K+ +L E + + +EL D Sbjct: 23 VLVLDTSASMSGNKIAELNEGLRILTDELKEDD 55 >UniRef50_UPI0000E488A7 Cluster: PREDICTED: similar to Clca1 protein; n=5; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to Clca1 protein - Strongylocentrotus purpuratus Length = 966 Score = 34.3 bits (75), Expect = 1.6 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGD-YFSIIDF--ESII 489 +V VLDTSGSM G + +++ + + P + Y +I++F ESI+ Sbjct: 316 IVLVLDTSGSMDGERFDKMIRGAKNFIQSIVPNNSYVAIVEFNYESIV 363 >UniRef50_A6GDG5 Cluster: Putative lipoprotein; n=1; Plesiocystis pacifica SIR-1|Rep: Putative lipoprotein - Plesiocystis pacifica SIR-1 Length = 486 Score = 34.3 bits (75), Expect = 1.6 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 1/82 (1%) Frame = +1 Query: 241 GQFVVQYDVDRPKDGQILVNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSGRKMEQLKE 417 G V D+ +G+ + G +P + P+N + VLD S SM+G M +K Sbjct: 121 GDLSVHVDLRSKDEGRFQLQIGVASEIVSPSERLPMN--ITLVLDESTSMTGAPMYAMKA 178 Query: 418 AMYTILNELNPGDYFSIIDFES 483 I L GD S++ + + Sbjct: 179 TARAIAGSLREGDVISLVSWSN 200 >UniRef50_Q25AL0 Cluster: H0102C09.6 protein; n=6; Oryza sativa|Rep: H0102C09.6 protein - Oryza sativa (Rice) Length = 689 Score = 34.3 bits (75), Expect = 1.6 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 +V VLD S M G K+ LK M ++ L P D +I+ F Sbjct: 280 LVTVLDVSQGMMGDKLHMLKRGMRLVIASLGPADRLAIVAF 320 >UniRef50_Q9VJM0 Cluster: CG12455-PA, isoform A; n=4; Sophophora|Rep: CG12455-PA, isoform A - Drosophila melanogaster (Fruit fly) Length = 2190 Score = 34.3 bits (75), Expect = 1.6 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = +1 Query: 346 NKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +K +V +LD SGSM+G + K + +IL+ + D+F+I+ + S Sbjct: 241 SKDIVILLDHSGSMTGFRHHVAKFTIRSILDTFSNNDFFTILRYSS 286 >UniRef50_Q54CQ8 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 910 Score = 34.3 bits (75), Expect = 1.6 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +F++D SGSMSG ++ + A+ I+ LN F+I F S Sbjct: 348 IFLIDCSGSMSGNPIDSARRALEIIIRSLNEQCKFNIYCFGS 389 >UniRef50_A2E1S5 Cluster: von Willebrand factor type A domain containing protein; n=1; Trichomonas vaginalis G3|Rep: von Willebrand factor type A domain containing protein - Trichomonas vaginalis G3 Length = 688 Score = 34.3 bits (75), Expect = 1.6 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 5/76 (6%) Frame = +1 Query: 271 RPKDGQILV-NDGYFV----HFFAPDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTIL 435 + KD I + +DGY +F + N F++D SGSMSG ++ K + + Sbjct: 204 KDKDNNIAIWSDGYIAISTFTYFETKVHS-NSEFYFIIDCSGSMSGSCIQNAKLCLNIFM 262 Query: 436 NELNPGDYFSIIDFES 483 + L G FSII F S Sbjct: 263 HSLPIGCRFSIIKFGS 278 >UniRef50_Q11GJ8 Cluster: Putative uncharacterized protein precursor; n=1; Mesorhizobium sp. BNC1|Rep: Putative uncharacterized protein precursor - Mesorhizobium sp. (strain BNC1) Length = 549 Score = 33.9 bits (74), Expect = 2.1 Identities = 13/31 (41%), Positives = 24/31 (77%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELN 447 + VLDT+GSM G K++ +KEA+ ++++L+ Sbjct: 142 IALVLDTTGSMRGGKLQAMKEAVNGLIDDLS 172 >UniRef50_Q021L5 Cluster: Von Willebrand factor, type A precursor; n=1; Solibacter usitatus Ellin6076|Rep: Von Willebrand factor, type A precursor - Solibacter usitatus (strain Ellin6076) Length = 337 Score = 33.9 bits (74), Expect = 2.1 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = +1 Query: 322 FAPDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 FA + P++ +V V D SGSM G K+ + + A+ L+ NP D FS++ F Sbjct: 103 FASEDVPVS--IVIVFDCSGSM-GPKLAKSRAAVAAFLSSANPEDEFSLVLF 151 >UniRef50_A7KFS5 Cluster: TerY1; n=6; root|Rep: TerY1 - Klebsiella pneumoniae Length = 239 Score = 33.9 bits (74), Expect = 2.1 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 V +LDTSGSM G +E +K + T+L L Y S+IT Sbjct: 33 VYLLLDTSGSMHGEPIEAVKNGVQTLLTTLKQDPYALETAHVSVIT 78 >UniRef50_A6GBY0 Cluster: Putative uncharacterized protein; n=1; Plesiocystis pacifica SIR-1|Rep: Putative uncharacterized protein - Plesiocystis pacifica SIR-1 Length = 996 Score = 33.9 bits (74), Expect = 2.1 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +1 Query: 355 VVFVLDTSGSMS-GRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 ++ V+D SGSMS G +++ +KEA L+P D +I F++ Sbjct: 530 LILVIDKSGSMSSGDRLDLVKEAARATARTLDPSDEIGVIAFDN 573 >UniRef50_A6FSF9 Cluster: Putative uncharacterized protein; n=1; Roseobacter sp. AzwK-3b|Rep: Putative uncharacterized protein - Roseobacter sp. AzwK-3b Length = 2459 Score = 33.9 bits (74), Expect = 2.1 Identities = 20/64 (31%), Positives = 33/64 (51%) Frame = -1 Query: 337 VGQERRNGRNIHRSLEFVHLSVDLHHIVQQIDLKHLLPHFPL*QILSISPHIRASIVFAL 158 +G RN +H+ + H ++D+ + QQ+D KH+L L +LS R+ +V L Sbjct: 1363 IGNRHRNTTVVHQGGIYNHKTIDIAELEQQVDAKHVLR--LLHTVLSECMAYRSEVVEKL 1420 Query: 157 LNLA 146 LA Sbjct: 1421 TQLA 1424 >UniRef50_A3I4T6 Cluster: Putative uncharacterized protein; n=1; Bacillus sp. B14905|Rep: Putative uncharacterized protein - Bacillus sp. B14905 Length = 865 Score = 33.9 bits (74), Expect = 2.1 Identities = 21/49 (42%), Positives = 25/49 (51%) Frame = +1 Query: 334 LPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFE 480 LP L + VLD SGSMSG K+E KEA + L D I F+ Sbjct: 404 LPSLG--LAIVLDRSGSMSGSKLELAKEAAARSVEMLRDEDTLGFIAFD 450 >UniRef50_Q54DV3 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 918 Score = 33.9 bits (74), Expect = 2.1 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 +F++D SGSMSG+ + + + AM I+ LN +I F S Sbjct: 301 IFLIDCSGSMSGQSINKARRAMEIIIRSLNEQHKVNIYCFGS 342 >UniRef50_Q9NY47 Cluster: Voltage-dependent calcium channel subunit alpha-2/delta-2 precursor (Voltage-gated calcium channel subunit alpha-2/delta-2) [Contains: Voltage-dependent calcium channel subunit alpha-2-2; Voltage-dependent calcium channel subunit delta-2]; n=91; Euteleostomi|Rep: Voltage-dependent calcium channel subunit alpha-2/delta-2 precursor (Voltage-gated calcium channel subunit alpha-2/delta-2) [Contains: Voltage-dependent calcium channel subunit alpha-2-2; Voltage-dependent calcium channel subunit delta-2] - Homo sapiens (Human) Length = 1150 Score = 33.9 bits (74), Expect = 2.1 Identities = 14/43 (32%), Positives = 28/43 (65%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 K +V ++D SGS+SG ++ +K ++ +L+ L+ DY ++ F Sbjct: 290 KDMVIIVDVSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASF 332 >UniRef50_UPI0000499288 Cluster: conserved hypothetical protein; n=7; Entamoeba histolytica HM-1:IMSS|Rep: conserved hypothetical protein - Entamoeba histolytica HM-1:IMSS Length = 694 Score = 33.5 bits (73), Expect = 2.7 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +1 Query: 346 NKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 N +VF+ D SGSM G ++ L+ + L +L F II F S Sbjct: 211 NINIVFICDRSGSMYGEGIKALRNMLQLFLRQLPLNSKFQIISFGS 256 >UniRef50_UPI000023E141 Cluster: hypothetical protein FG02816.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG02816.1 - Gibberella zeae PH-1 Length = 1045 Score = 33.5 bits (73), Expect = 2.7 Identities = 20/53 (37%), Positives = 27/53 (50%) Frame = +1 Query: 334 LPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 LP +VF+ D SGSMS ++ LK A+ L + G F+I F S T Sbjct: 285 LPAEKPEIVFICDRSGSMSD-QISNLKTALEVFLKSMPVGVKFNICSFGSSFT 336 >UniRef50_A0VIA9 Cluster: Von Willebrand factor, type A precursor; n=1; Delftia acidovorans SPH-1|Rep: Von Willebrand factor, type A precursor - Delftia acidovorans SPH-1 Length = 536 Score = 33.5 bits (73), Expect = 2.7 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAM 423 +FVLD SGSM G ++ Q+KEA+ Sbjct: 342 IFVLDVSGSMKGARLAQMKEAL 363 >UniRef50_Q8LQ58 Cluster: Zinc finger (C3HC4-type RING finger)-like protein; n=8; Oryza sativa|Rep: Zinc finger (C3HC4-type RING finger)-like protein - Oryza sativa subsp. japonica (Rice) Length = 589 Score = 33.5 bits (73), Expect = 2.7 Identities = 14/41 (34%), Positives = 27/41 (65%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 +V V+D SGSM G +++++K A+ ++ +L+ D I+ F Sbjct: 70 LVAVIDVSGSMDGDRIDKVKTALQFVIRKLSDLDRLCIVTF 110 >UniRef50_A0CCS0 Cluster: Chromosome undetermined scaffold_168, whole genome shotgun sequence; n=6; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_168, whole genome shotgun sequence - Paramecium tetraurelia Length = 981 Score = 33.5 bits (73), Expect = 2.7 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +1 Query: 358 VFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 +F +D SGSMSG ++++ K+++ L L F+II F Sbjct: 351 LFFIDRSGSMSGGRIKKAKQSLILFLRSLPDNCRFNIISF 390 >UniRef50_Q7WHE1 Cluster: Putative exported protein; n=2; Bordetella|Rep: Putative exported protein - Bordetella bronchiseptica (Alcaligenes bronchisepticus) Length = 571 Score = 33.1 bits (72), Expect = 3.6 Identities = 17/50 (34%), Positives = 32/50 (64%), Gaps = 1/50 (2%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSGR-KMEQLKEAMYTILNELNPGDYFSIIDF 477 D+P +N +V ++DTSGSM+ R K+ LK A+ ++ ++ D +I+ + Sbjct: 205 DIPAVN--LVLLIDTSGSMADRAKLPLLKSALRQLVTQMRAQDRVAIVAY 252 >UniRef50_Q1DCJ2 Cluster: Putative uncharacterized protein; n=2; Cystobacterineae|Rep: Putative uncharacterized protein - Myxococcus xanthus (strain DK 1622) Length = 424 Score = 33.1 bits (72), Expect = 3.6 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNELNPG 453 VVFVLDT+GSMSG +E K +Y+I + + G Sbjct: 83 VVFVLDTTGSMSG-LLEGAKRKIYSIASRIAQG 114 >UniRef50_A5P2L4 Cluster: von Willebrand factor, type A; n=3; Proteobacteria|Rep: von Willebrand factor, type A - Methylobacterium sp. 4-46 Length = 720 Score = 33.1 bits (72), Expect = 3.6 Identities = 20/68 (29%), Positives = 42/68 (61%), Gaps = 2/68 (2%) Frame = +1 Query: 280 DGQILVNDGYFVHFFAP-DLPPLNKYVVFVLDTSGSMSG-RKMEQLKEAMYTILNELNPG 453 +G+ L++ G + AP + PP N +VF++DTSGSM+ ++ +K+++ +L L+ Sbjct: 317 EGRKLLHIGIRGYAVAPAERPPAN--LVFLVDTSGSMAAPNRLPLVKQSLAMLLTTLDAR 374 Query: 454 DYFSIIDF 477 D +++ + Sbjct: 375 DRVALVAY 382 >UniRef50_A0MNC5 Cluster: Putative uncharacterized protein; n=1; Thermus phage phiYS40|Rep: Putative uncharacterized protein - Thermus phage phiYS40 Length = 562 Score = 33.1 bits (72), Expect = 3.6 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = +1 Query: 343 LNKYVVFVLDTSGSMSGRKMEQ-LKEAMYTILNELNPGDYFSIIDFESIITVH 498 L YV+ +DTSGSM +E+ +K + + N N YF+ +DF+ I V+ Sbjct: 429 LEMYVI--VDTSGSMGNEDLEKSIKILRFLVENNANVHLYFNDVDFQEIENVN 479 >UniRef50_Q8IB60 Cluster: Transport protein; n=9; Plasmodium|Rep: Transport protein - Plasmodium falciparum (isolate 3D7) Length = 759 Score = 33.1 bits (72), Expect = 3.6 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGD-YFSIIDFESIITVHE 501 D+PP +FV+DT + ++EQLK+++ ++ L PGD Y II F ++ VHE Sbjct: 121 DIPPPT--FLFVIDTC--LLEEELEQLKDSIQQCIS-LMPGDAYIGIITFGNMCYVHE 173 >UniRef50_A7RPC2 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 930 Score = 33.1 bits (72), Expect = 3.6 Identities = 17/49 (34%), Positives = 28/49 (57%) Frame = +1 Query: 337 PPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFES 483 PP + V+FVLD S SM G+ +++ K+ L+ + F+I+ F S Sbjct: 650 PPHHVEVIFVLDASCSMKGKALQEAKKLTLMCLSLMEEEWAFNIVVFGS 698 >UniRef50_A7RFL6 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 981 Score = 33.1 bits (72), Expect = 3.6 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +1 Query: 301 DGYFVHFFAPDLPPLNKYVVFVLDTSGSMS-GRKMEQLKEAMYTILNELNPGDYFSIIDF 477 D F ++ + + +V V+D S SMS +M ++A T+L+ L P D ++ F Sbjct: 200 DPRFQSWYVEAVTRMRTNIVVVIDRSSSMSTAGRMALARQAAVTVLDTLGPNDKVGVVAF 259 Query: 478 ESII 489 I Sbjct: 260 SHFI 263 >UniRef50_A2DWC0 Cluster: von Willebrand factor type A domain containing protein; n=1; Trichomonas vaginalis G3|Rep: von Willebrand factor type A domain containing protein - Trichomonas vaginalis G3 Length = 729 Score = 33.1 bits (72), Expect = 3.6 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +1 Query: 346 NKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 N F++D SGSM +++ K + +++ L G FSII F S+ V Sbjct: 232 NSEFYFIIDCSGSMEESRIKNAKFCLNLLIHSLPVGCRFSIIKFGSMYEV 281 >UniRef50_Q13349 Cluster: Integrin alpha-D precursor; n=21; Mammalia|Rep: Integrin alpha-D precursor - Homo sapiens (Human) Length = 1162 Score = 33.1 bits (72), Expect = 3.6 Identities = 13/58 (22%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 328 PDLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGD-YFSIIDFESIITVH 498 P+ P +VF++D SGS+ Q+K + ++ + D F+++ + +++ +H Sbjct: 142 PECPHQEMDIVFLIDGSGSIDQNDFNQMKGFVQAVMGQFEGTDTLFALMQYSNLLKIH 199 >UniRef50_UPI0000ECA631 Cluster: CDK5 regulatory subunit-associated protein 2 (CDK5 activator-binding protein C48) (Centrosome-associated protein 215).; n=1; Gallus gallus|Rep: CDK5 regulatory subunit-associated protein 2 (CDK5 activator-binding protein C48) (Centrosome-associated protein 215). - Gallus gallus Length = 1813 Score = 32.7 bits (71), Expect = 4.8 Identities = 24/86 (27%), Positives = 43/86 (50%) Frame = +2 Query: 8 LRKRQIFRNCECPKLELEMKSTPQKMTLKCQTLSFKEKAPLRSLRSRQI*KSKND*CTYM 187 LR + ++ E KL+ +K T Q++ L+ +++ + L Q+ KS++D Sbjct: 343 LRSENLTKDAENHKLQRRIKRTDQELN----DLNLEKEKMEKELDEAQLQKSRSDKTIND 398 Query: 188 RRNRKNLLQGKMREKVF*VNLLYNMM 265 RN+ L G+M EK V YN++ Sbjct: 399 LRNQVEKLHGEMAEKEKAVEHHYNIL 424 >UniRef50_Q8DA69 Cluster: Putative uncharacterized protein; n=2; Vibrio vulnificus|Rep: Putative uncharacterized protein - Vibrio vulnificus Length = 465 Score = 32.7 bits (71), Expect = 4.8 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 355 VVFVLDTSGSMSGRKMEQLKEAMYTILNEL 444 +VF+LD S SMSG M + KEA+ ++L Sbjct: 129 IVFMLDVSNSMSGEPMNKTKEALLAFADKL 158 >UniRef50_A5G649 Cluster: UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase; n=1; Geobacter uraniumreducens Rf4|Rep: UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase - Geobacter uraniumreducens Rf4 Length = 337 Score = 32.7 bits (71), Expect = 4.8 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 7/93 (7%) Frame = +1 Query: 121 GTSAVITFSPDLEEQKRLMHVYAEKSKESATGENAGEGVLGQFVVQYDVDRPKDGQILVN 300 GT IT DLE Q+ +AE K +N+ L +++ D + P+ ILVN Sbjct: 16 GTDCEITGISDLEHQEEGTIAFAENKKSMDILKNSQVSAL---IIKKDSELPEKPVILVN 72 Query: 301 DGYF-----VHFFAPDLP-PLNKYV-VFVLDTS 378 D F + F+P P P+ +Y V+V T+ Sbjct: 73 DPKFAFTKIIELFSPYKPYPVKQYENVYVESTA 105 >UniRef50_A0NVX5 Cluster: Putative uncharacterized protein; n=1; Stappia aggregata IAM 12614|Rep: Putative uncharacterized protein - Stappia aggregata IAM 12614 Length = 608 Score = 32.7 bits (71), Expect = 4.8 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMS-GRKMEQLKEAMYTILNELNPGDYFSIIDF 477 DLP N +VF++DTSGSM+ K+ L+++ +L+ L D +I+ + Sbjct: 243 DLPSQN--LVFLIDTSGSMADANKLPLLQQSFRLLLSSLRDEDEVAIVTY 290 >UniRef50_A7SCF0 Cluster: Predicted protein; n=2; Eumetazoa|Rep: Predicted protein - Nematostella vectensis Length = 120 Score = 32.7 bits (71), Expect = 4.8 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 349 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIIT 492 K V+ ++D SGSM G M K + +++ D+F++I IT Sbjct: 71 KDVIIMVDASGSMRGVPMRIAKLSAMALIDTFEDNDFFNVISVSCYIT 118 >UniRef50_A7S951 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 658 Score = 32.7 bits (71), Expect = 4.8 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Frame = -3 Query: 371 SRTKT-TYLLSGGRSGAKKWTKYPSFTRICPSFGRSTSYCTTN*PKTPSPAFSPVADSFD 195 S T T +Y + + +T PS+T S+ +TSY +T TP+P+++ Sbjct: 442 SYTSTPSYTSTTSYTSTTSYTSTPSYTSTT-SYTSTTSYTSTT-SYTPTPSYTSTTSYTP 499 Query: 194 FSAYTCINRFCSSKS 150 +YTC + S+ S Sbjct: 500 TPSYTCTTSYTSTTS 514 >UniRef50_A6NIY6 Cluster: Uncharacterized protein MAN1B1; n=2; Homo sapiens|Rep: Uncharacterized protein MAN1B1 - Homo sapiens (Human) Length = 865 Score = 32.7 bits (71), Expect = 4.8 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = +3 Query: 138 YVLARFRRAKTIDARICGEIERICYRGKCGRRCFRSICCTI*CRSTERW 284 Y+L + R+ + +R C R CY C R C T CR RW Sbjct: 457 YMLLQACRSVVLHSRCCRRAGRCCYTHSCCCRSTGRWCYTCCCRCAGRW 505 >UniRef50_UPI000069E6F8 Cluster: dachsous 2 isoform 1; n=1; Xenopus tropicalis|Rep: dachsous 2 isoform 1 - Xenopus tropicalis Length = 2689 Score = 32.3 bits (70), Expect = 6.3 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 5/64 (7%) Frame = +1 Query: 325 APDLPPLNKYVVFVLDTS-----GSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESII 489 AP +PP+N V+ D + GS+S ++ + YT NPG F+I + II Sbjct: 1670 APTIPPMNT-VLIAEDAAPGYSIGSISANDVDLRPDLSYTFTENGNPGLKFAIDRYSGII 1728 Query: 490 TVHE 501 T+ E Sbjct: 1729 TLTE 1732 >UniRef50_Q67LZ3 Cluster: Putative uncharacterized protein; n=1; Symbiobacterium thermophilum|Rep: Putative uncharacterized protein - Symbiobacterium thermophilum Length = 414 Score = 32.3 bits (70), Expect = 6.3 Identities = 16/53 (30%), Positives = 32/53 (60%) Frame = +1 Query: 337 PPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITV 495 PPLN + V+D SGSM+G + K+A+ +++++ D +I+ ++ + V Sbjct: 41 PPLN--LAAVVDRSGSMAGAALYFTKQALRFLVDQMAEEDRLAIVTYDDQVHV 91 >UniRef50_A6CIG8 Cluster: Putative uncharacterized protein; n=1; Bacillus sp. SG-1|Rep: Putative uncharacterized protein - Bacillus sp. SG-1 Length = 931 Score = 32.3 bits (70), Expect = 6.3 Identities = 20/50 (40%), Positives = 26/50 (52%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFE 480 +LP L +V VLD SGSM+G K++ KEA L D I F+ Sbjct: 404 ELPSLG--MVIVLDRSGSMAGYKIQLAKEAAIRSAELLREKDTLGFIAFD 451 >UniRef50_A0C9G5 Cluster: Chromosome undetermined scaffold_16, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_16, whole genome shotgun sequence - Paramecium tetraurelia Length = 648 Score = 32.3 bits (70), Expect = 6.3 Identities = 13/39 (33%), Positives = 26/39 (66%) Frame = +1 Query: 364 VLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFE 480 V+D SGSM G+K+ +++++ +L+ L+ D +I F+ Sbjct: 233 VIDKSGSMEGKKIASVQQSLVQLLDFLSEKDRLCLITFD 271 >UniRef50_A0MEB5 Cluster: Cyclin-A3-3; n=5; rosids|Rep: Cyclin-A3-3 - Arabidopsis thaliana (Mouse-ear cress) Length = 327 Score = 32.3 bits (70), Expect = 6.3 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 2/72 (2%) Frame = +1 Query: 49 IRTGNEVDATKDDAQMSNVIIQREGTSAVITFSPDLEEQKRL--MHVYAEKSKESATGEN 222 I++G+++DA DD QM + + S + + +LE + +L +H Y EK +E T Sbjct: 37 IQSGSDIDARSDDPQMCGLYV-----SDIYEYLRELEVKPKLRPLHDYIEKIQEDITPSK 91 Query: 223 AGEGVLGQFVVQ 258 GVL ++V+ Sbjct: 92 --RGVLVDWLVE 101 >UniRef50_Q4RTV2 Cluster: Chromosome 12 SCAF14996, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 12 SCAF14996, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 821 Score = 31.9 bits (69), Expect = 8.3 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -3 Query: 230 SPAFSPVADSFDFSAYTCINRFCSSKSGENVMTAEVP 120 S +F+ S D A+TC+ FCS+ SGE A+ P Sbjct: 763 SLSFTTSWRSRDQDAFTCLQAFCSAVSGEKTPDAKAP 799 >UniRef50_Q3DYV9 Cluster: Von Willebrand factor, type A; n=2; Chloroflexus|Rep: Von Willebrand factor, type A - Chloroflexus aurantiacus J-10-fl Length = 845 Score = 31.9 bits (69), Expect = 8.3 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Frame = +1 Query: 355 VVFVLDTSGSMSGR----KMEQLKEAMYTILNELNPGDYFSIIDFES 483 ++F++D S SMS K + KEA L L PGD ++ F++ Sbjct: 397 ILFIIDRSASMSATFGISKFDMAKEAAILSLTTLQPGDRVGVLAFDT 443 >UniRef50_Q2B7C3 Cluster: Putative uncharacterized protein; n=1; Bacillus sp. NRRL B-14911|Rep: Putative uncharacterized protein - Bacillus sp. NRRL B-14911 Length = 920 Score = 31.9 bits (69), Expect = 8.3 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +1 Query: 331 DLPPLNKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFE 480 ++P L ++ V+D SGSM+G K+E KEA + L D I F+ Sbjct: 399 EMPSLG--LMIVMDRSGSMAGSKLELAKEAAARSVELLREKDTLGFIAFD 446 >UniRef50_Q1D6F9 Cluster: Von Willebrand factor type A domain protein; n=2; Cystobacterineae|Rep: Von Willebrand factor type A domain protein - Myxococcus xanthus (strain DK 1622) Length = 592 Score = 31.9 bits (69), Expect = 8.3 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +1 Query: 352 YVVFVLDTSGSM-SGRKMEQLKEAMYTILNELNPGDYFSIIDF 477 ++VF++DTSGSM S K+ +EA+ + LN D +I+ + Sbjct: 245 HLVFLVDTSGSMHSEDKLPLAREAIKVAVKNLNENDTVAIVTY 287 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.315 0.134 0.374 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 482,333,678 Number of Sequences: 1657284 Number of extensions: 9518460 Number of successful extensions: 28958 Number of sequences better than 10.0: 253 Number of HSP's better than 10.0 without gapping: 27962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28861 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 29691847201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits)
- SilkBase 1999-2023 -