BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_E02 (555 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 25 0.68 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 2.7 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 6.3 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 8.4 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 24.6 bits (51), Expect = 0.68 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 196 KFINLRDANALKLEWGTDRDGDRGAYGDKNEWESD 300 +++ L + + LEWG GD +EW+SD Sbjct: 173 QYLRLLEVPQINLEWGEGSSGD----DLSSEWDSD 203 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 364 VPQFQSTPSGSTNEGLFSKTF 302 +P ST + ++ +GLFSK F Sbjct: 675 LPSLPSTLTKNSKQGLFSKLF 695 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 4.8 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 208 LRDANALKLEWGTDRDGDRGAYGDKNEWESD 300 LRD N + L DG G GD++ +D Sbjct: 183 LRDINDIGLNRRDSDDGSDGNDGDESSCRAD 213 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 6.3 Identities = 11/41 (26%), Positives = 15/41 (36%) Frame = -1 Query: 444 CSCPPNALCSPSLSEFDSSFKYCPNCLFHNFKVRPLVPPMR 322 C PP + LS + CP FH R + P + Sbjct: 1701 CPPPPRMGSAEGLSHRGMEDEICPYATFHLLGFREEMDPSK 1741 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.0 bits (42), Expect = 8.4 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 339 LVPPMRDYFPRHSITLPFVFVTVRTSIAISVC 244 ++PP P L F + V SI I+VC Sbjct: 301 IIPPTSLAIPLLGKYLLFTMILVTLSIWITVC 332 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,600 Number of Sequences: 438 Number of extensions: 3634 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -