BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0003_E02 (555 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g44100.1 68418.m05396 casein kinase, putative similar to dual... 31 0.39 At1g03930.1 68414.m00378 protein kinase (ADK1) identical to dual... 31 0.39 At4g28540.1 68417.m04083 casein kinase, putative similar to case... 30 0.90 At3g24440.1 68416.m03067 fibronectin type III domain-containing ... 30 1.2 At4g26100.3 68417.m03758 casein kinase, putative similar to case... 29 1.6 At4g26100.1 68417.m03757 casein kinase, putative similar to case... 29 1.6 At3g23340.1 68416.m02944 casein kinase, putative similar to case... 29 1.6 At5g61350.1 68418.m07698 protein kinase family protein contains ... 29 2.1 At2g39360.1 68415.m04831 protein kinase family protein contains ... 29 2.1 At5g03540.1 68418.m00310 exocyst subunit EXO70 family protein co... 29 2.8 At1g72710.1 68414.m08408 casein kinase, putative similar to case... 29 2.8 At4g28880.1 68417.m04127 casein kinase, putative similar to simi... 28 3.6 At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain... 28 3.6 At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain... 28 3.6 At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain... 28 3.6 At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain... 28 3.6 At5g57015.1 68418.m07116 casein kinase, putative similar to case... 28 4.8 At4g15093.1 68417.m02319 catalytic LigB subunit of aromatic ring... 28 4.8 At1g70430.1 68414.m08103 protein kinase family protein contains ... 28 4.8 At4g28860.1 68417.m04124 casein kinase, putative similar to case... 27 6.4 At5g14950.1 68418.m01754 glycosyl hydrolase family 38 protein si... 27 8.4 At4g14340.1 68417.m02208 casein kinase I (CKI1) identical to cas... 27 8.4 At3g54100.1 68416.m05981 expressed protein similar to axi 1 [Nic... 27 8.4 At3g13820.1 68416.m01745 F-box family protein contains Pfam PF00... 27 8.4 At1g23700.1 68414.m02992 protein kinase family protein contains ... 27 8.4 >At5g44100.1 68418.m05396 casein kinase, putative similar to dual specificity kinase 1 gi|1216484|gb|AAB47968 Length = 476 Score = 31.5 bits (68), Expect = 0.39 Identities = 21/65 (32%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Frame = -1 Query: 471 KYHRCLHVSCSCPPNALCSPSLSEFDSSFKYCPNCLFHNFKVRPLVPPM-RDYFPRHSIT 295 KY R S P LC SEF S F YC + F + + + RD F R Sbjct: 224 KYDRISEKKVSTPIEVLCKNQPSEFVSYFHYCRSLRFDDKPDYSYLKRLFRDLFIREGYQ 283 Query: 294 LPFVF 280 +VF Sbjct: 284 FDYVF 288 >At1g03930.1 68414.m00378 protein kinase (ADK1) identical to dual specificity kinase 1 (ADK1) [Arabidopsis thaliana] gi|1216484|gb|AAB47968; supported by cDNA gi:18700076 and gi:1216483. Note: differences between cDNAs in the 11th exon, possibly due to errors or alternative splicing. Length = 471 Score = 31.5 bits (68), Expect = 0.39 Identities = 20/65 (30%), Positives = 27/65 (41%), Gaps = 1/65 (1%) Frame = -1 Query: 471 KYHRCLHVSCSCPPNALCSPSLSEFDSSFKYCPNCLFHNFKVRPLVPPM-RDYFPRHSIT 295 KY R + P LC SEF S F+YC + F + + + RD F R Sbjct: 224 KYDRISEKKVATPIEVLCKNQPSEFVSYFRYCRSLRFDDKPDYSYLKRLFRDLFIREGYQ 283 Query: 294 LPFVF 280 +VF Sbjct: 284 FDYVF 288 >At4g28540.1 68417.m04083 casein kinase, putative similar to casein kinase I [Arabidopsis thaliana] gi|1103318|emb|CAA55395; contains protein kinase domain, Pfam:PF00069 Length = 479 Score = 30.3 bits (65), Expect = 0.90 Identities = 20/65 (30%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Frame = -1 Query: 471 KYHRCLHVSCSCPPNALCSPSLSEFDSSFKYCPNCLFHNFKVRPLVPPM-RDYFPRHSIT 295 KY R S P LC EF S F+YC + F + + + RD F R Sbjct: 228 KYDRISEKKVSTPIEVLCKSYPPEFVSYFQYCRSLRFEDKPDYSYLKRLFRDLFIREGYQ 287 Query: 294 LPFVF 280 +VF Sbjct: 288 FDYVF 292 >At3g24440.1 68416.m03067 fibronectin type III domain-containing protein contains Pfam profile PF00041: Fibronectin type III domain Length = 602 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -1 Query: 459 CLHVSCSCPPNALCSPSLSEFDSSFKYCPNCLFHNF 352 CL S C NA C ++ + DS K C C+ HNF Sbjct: 42 CLRSSWICK-NASCRANVPKEDSFCKRCSCCVCHNF 76 >At4g26100.3 68417.m03758 casein kinase, putative similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158; contains protein kinase domain, Pfam:PF00069 Length = 450 Score = 29.5 bits (63), Expect = 1.6 Identities = 22/65 (33%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = -1 Query: 471 KYHRCLHVSCSCPPNALCSPSLSEFDSSFKYCPNCLFHNF-KVRPLVPPMRDYFPRHSIT 295 KY R S ALC SEF S F YC + F + L RD F R Sbjct: 224 KYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQ 283 Query: 294 LPFVF 280 +VF Sbjct: 284 FDYVF 288 >At4g26100.1 68417.m03757 casein kinase, putative similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158; contains protein kinase domain, Pfam:PF00069 Length = 450 Score = 29.5 bits (63), Expect = 1.6 Identities = 22/65 (33%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = -1 Query: 471 KYHRCLHVSCSCPPNALCSPSLSEFDSSFKYCPNCLFHNF-KVRPLVPPMRDYFPRHSIT 295 KY R S ALC SEF S F YC + F + L RD F R Sbjct: 224 KYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQ 283 Query: 294 LPFVF 280 +VF Sbjct: 284 FDYVF 288 >At3g23340.1 68416.m02944 casein kinase, putative similar to casein kinase I [Arabidopsis thaliana] gi|1197461|emb|CAA55396 Length = 442 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/65 (29%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = -1 Query: 471 KYHRCLHVSCSCPPNALCSPSLSEFDSSFKYCPNCLFHNFKVRPLVPPM-RDYFPRHSIT 295 KY + P LC SEF S F YC + F + + + RD F R Sbjct: 224 KYEKISEKKMLTPVEVLCKSYPSEFTSYFHYCRSLRFEDKPDYSYLKRLFRDLFIREGYQ 283 Query: 294 LPFVF 280 +VF Sbjct: 284 FDYVF 288 >At5g61350.1 68418.m07698 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 842 Score = 29.1 bits (62), Expect = 2.1 Identities = 23/69 (33%), Positives = 31/69 (44%) Frame = +1 Query: 52 RLVVNKLLAESKRNVVDYAYKLVRKGEIGIVRDYFPIHFRWILLGEQVKFINLRDANALK 231 R V+N L + N+ +YA L RKG + + D P I G KF+ A Sbjct: 728 RPVINPQLPREQVNLAEYAMNLHRKGMLEKIID--PKIVGTISKGSLRKFVEA--AEKCL 783 Query: 232 LEWGTDRDG 258 E+G DR G Sbjct: 784 AEYGVDRPG 792 >At2g39360.1 68415.m04831 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 815 Score = 29.1 bits (62), Expect = 2.1 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +1 Query: 52 RLVVNKLLAESKRNVVDYAYKLVRKGEIGIVRDYF 156 R V++ L K N++++A KLV+KG++ + D F Sbjct: 686 RPVIDPSLPREKVNLIEWAMKLVKKGKLEDIIDPF 720 >At5g03540.1 68418.m00310 exocyst subunit EXO70 family protein contains Pfam domain PF03081: Exo70 exocyst complex subunit Length = 638 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 389 LESNSDSDGEHKAFGGHEHDTWRHLWYFHPVVVGSETV 502 L +SD DG K GGH +D Y P+++ S + Sbjct: 170 LRPSSDGDGGGKPHGGHHNDDAETAAYTLPILIPSRVL 207 >At1g72710.1 68414.m08408 casein kinase, putative similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158 Length = 465 Score = 28.7 bits (61), Expect = 2.8 Identities = 20/65 (30%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Frame = -1 Query: 471 KYHRCLHVSCSCPPNALCSPSLSEFDSSFKYCPNCLFHNFKVRPLVPPM-RDYFPRHSIT 295 KY + S ALC SEF S F YC + F + + + RD F R Sbjct: 223 KYEKISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRLFRDLFIREGFQ 282 Query: 294 LPFVF 280 +VF Sbjct: 283 FDYVF 287 >At4g28880.1 68417.m04127 casein kinase, putative similar to similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158; contains protein kinase domain, Pfam:PF00069 Length = 415 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/65 (27%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = -1 Query: 471 KYHRCLHVSCSCPPNALCSPSLSEFDSSFKYCPNCLFHNFKVRPLVPPM-RDYFPRHSIT 295 KY + S P LC EF S F YC F + + RD F R Sbjct: 224 KYDKICEKKISTPIEVLCKNHPVEFASYFHYCHTLTFDQRPDYGFLKRLFRDLFSREGYE 283 Query: 294 LPFVF 280 ++F Sbjct: 284 FDYIF 288 >At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = -2 Query: 551 STQASTPGCSFC*K*RTPSHSQLPLGGSTTDVSMCRVRVLQTLYVHRHCRSLILVSN 381 +T +S+ S R+PS S+ PL S ++ YVHR+ R++ LV N Sbjct: 135 TTSSSSTTSSTSSSPRSPSLSKPPLPPSPPRITTVTKNPCYGCYVHRNSRNIYLVHN 191 >At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 218 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = -2 Query: 551 STQASTPGCSFC*K*RTPSHSQLPLGGSTTDVSMCRVRVLQTLYVHRHCRSLILVSN 381 +T +S+ S R+PS S+ PL S ++ YVHR+ R++ LV N Sbjct: 157 TTSSSSTTSSTSSSPRSPSLSKPPLPPSPPRITTVTKNPCYGCYVHRNSRNIYLVHN 213 >At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = -2 Query: 551 STQASTPGCSFC*K*RTPSHSQLPLGGSTTDVSMCRVRVLQTLYVHRHCRSLILVSN 381 +T +S+ S R+PS S+ PL S ++ YVHR+ R++ LV N Sbjct: 135 TTSSSSTTSSTSSSPRSPSLSKPPLPPSPPRITTVTKNPCYGCYVHRNSRNIYLVHN 191 >At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = -2 Query: 551 STQASTPGCSFC*K*RTPSHSQLPLGGSTTDVSMCRVRVLQTLYVHRHCRSLILVSN 381 +T +S+ S R+PS S+ PL S ++ YVHR+ R++ LV N Sbjct: 135 TTSSSSTTSSTSSSPRSPSLSKPPLPPSPPRITTVTKNPCYGCYVHRNSRNIYLVHN 191 >At5g57015.1 68418.m07116 casein kinase, putative similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158; contains protein kinase domain, Pfam:PF00069 Length = 435 Score = 27.9 bits (59), Expect = 4.8 Identities = 21/65 (32%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = -1 Query: 471 KYHRCLHVSCSCPPNALCSPSLSEFDSSFKYCPNCLFHNF-KVRPLVPPMRDYFPRHSIT 295 KY R S +LC SEF S F YC + F + L RD F R Sbjct: 224 KYERISEKKVSTSIESLCRGYPSEFASYFHYCRSLRFDDKPDYGYLKRIFRDLFIREGFQ 283 Query: 294 LPFVF 280 +VF Sbjct: 284 FDYVF 288 >At4g15093.1 68417.m02319 catalytic LigB subunit of aromatic ring-opening dioxygenase family contains Pfam PF02900: Catalytic LigB subunit of aromatic ring-opening dioxygenase Length = 269 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 262 RGAYGDKNEWESDRMSWKIIPHWWNQRAY 348 +G YGD NEWE + K + H W + Y Sbjct: 204 QGRYGDVNEWEEKAPNAK-MAHPWPEHLY 231 >At1g70430.1 68414.m08103 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 594 Score = 27.9 bits (59), Expect = 4.8 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -2 Query: 461 DVSMCRVRVLQTLYVHRHCRSLILVSNIVRIACSTISKYALW 336 D+ CR L+T+ H SLI N+++ CS I +LW Sbjct: 48 DLEKCR-NDLETIRKEVHIMSLIDHPNLLKAHCSFIDSSSLW 88 >At4g28860.1 68417.m04124 casein kinase, putative similar to casein kinase I, delta isoform [Arabidopsis thaliana] SWISS-PROT:P42158; contains protein kinase domain, Pfam:PF00069 Length = 414 Score = 27.5 bits (58), Expect = 6.4 Identities = 17/65 (26%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = -1 Query: 471 KYHRCLHVSCSCPPNALCSPSLSEFDSSFKYCPNCLFHNFKVRPLVPPM-RDYFPRHSIT 295 KY + S P LC EF S F YC F + + RD F R Sbjct: 224 KYDKICEKKISTPIEVLCKSHPVEFASYFHYCHTLTFDQRPDYGFLKRLFRDLFSREGYE 283 Query: 294 LPFVF 280 +++ Sbjct: 284 FDYIY 288 >At5g14950.1 68418.m01754 glycosyl hydrolase family 38 protein similar to alpha-mannosidase II SP:P27046 from [Mus musculus] Length = 1173 Score = 27.1 bits (57), Expect = 8.4 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +1 Query: 226 LKLEWGTDRDGDRGAYGDKNEWESDRMSWKIIPHWWNQRAYFEIVEQ 366 L + G + G R Y D +EWE +++ ++PH N + VE+ Sbjct: 128 LDTDGGPWKQGWRVTYKD-DEWEKEKLKIFVVPHSHNDPGWKLTVEE 173 >At4g14340.1 68417.m02208 casein kinase I (CKI1) identical to casein kinase I [Arabidopsis thaliana] gi|1103318|emb|CAA55395 Length = 457 Score = 27.1 bits (57), Expect = 8.4 Identities = 19/65 (29%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = -1 Query: 471 KYHRCLHVSCSCPPNALCSPSLSEFDSSFKYCPNCLFHNFKVRPLVPPM-RDYFPRHSIT 295 KY + LC SEF S F YC + F + + + RD F R Sbjct: 230 KYDKISEKKMLTSVETLCKSYPSEFTSYFHYCRSLRFEDKPDYSYLRRLFRDLFIREGYQ 289 Query: 294 LPFVF 280 L +VF Sbjct: 290 LDYVF 294 >At3g54100.1 68416.m05981 expressed protein similar to axi 1 [Nicotiana tabacum] GI:559921; contains Pfam profile PF03138: Plant protein family Length = 638 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 392 ESNSDSDGEHKAFGGHEHDTWRHLWYFHPVV 484 +S+ S+ + G H H H +Y HPV+ Sbjct: 60 DSSPSSESSASSTGSHYHHDHYHRFYSHPVI 90 >At3g13820.1 68416.m01745 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640: F-box protein interaction domain Length = 415 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +2 Query: 347 TLKLWNKQFGQYLKLESNSDSDGEHKAFGGHEHDTWRH 460 +L +WN GQ ++E +SD+D + G++++ H Sbjct: 110 SLLVWNPYLGQTRRIEVSSDADMNDRYALGYDNNNSSH 147 >At1g23700.1 68414.m02992 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 473 Score = 27.1 bits (57), Expect = 8.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 434 LQTLYVHRHCRSLILVSNIVRIACSTISKYALW 336 L+T+ H SLI N++R+ CS I +LW Sbjct: 52 LETIRKEVHRLSLIDHPNLLRVHCSFIDSSSLW 84 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,147,705 Number of Sequences: 28952 Number of extensions: 259311 Number of successful extensions: 790 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 790 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1053014392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -